ELF34!0$4 (.-444p000p((  A/usr/lib32/libc.so.1 _0_[,L X   P 40ppdpp ppppp%p%p&&p )p')p()p-p)0p STWp$, ppQ`p*p,8S9_ST9ݭA3TW8юX.text.init__Argc_mcount__startexit_environmain__rld_obj_head__Argv__istart__readenv_sigfpe.debug_info.debug_pubnames.debug_line.debug_aranges.debug_frame.debug_abbrev__do_global_dtors__deregister_frame_info__EH_FRAME_BEGIN____frame_dummy__register_frame_info.data.rodata.bss.ctors.dtors.eh_frameis_definedWordnet_Initwninithelptextmorphstrwn_senseflagtkwn_doeventsatoiwn_glossesinterface_doevents_funcwn_bitfindtheinfoabortsearchdisplay_messagere_wninitTcl_CreateCommandwn_findvalidsearchesTcl_DoOneEventfprintfwnsnsflagstrcatwn_fileinfotkwn_displayerrordflagwn_contextualhelpwn_byteoffsetoffsetflagfileinfoflagsprintf__iobwn_reopendbstrcpywn_abortsearchwn_searchTcl_SetVarTk_MainTcl_StaticPackageTk_SafeInitTk_InitTcl_InitTcl_AppInittclDummyMathPtrmatherrTkAllocWindowTk_DestroyWindowTkWmNewWindowTk_GetUidtkActiveUidtkDisabledUidTk_CreateImageTypetkNormalUidtkBitmapImageTypetkPhotoImageTypeTk_CreatePhotoImageFormattkImgFmtGIFtkImgFmtPPMTcl_CreateExitHandlerTkGetDefaultScreenNamestrlen__libc_attrstrncmptkDisplayListTkpOpenDisplaymallocstrncpyTkInitXIdTcl_InitHashTablestrtoulTcl_AppendResultTkGetDisplayfreeTkCreateMainWindowTkBindInitTkFontPkgInitTcl_LinkVarTcl_ResetResulttkMainWindowListTk_SetAppNameTcl_IsSafeTcl_CreateObjCommandTcl_HideCommandpanicTk_CreateWindowTk_CreateWindowFromPathstrrchrTk_NameToWindowTkFocusDeadWindowTkpGetOtherWindowTk_HandleEventTkWmDeadWindowTkFreeWindowIdXDestroyWindowTcl_DeleteHashEntryTkEventDeadWindowTkBindDeadWindowXDestroyICTkOptionDeadWindowTkSelDeadWindowTkGrabDeadWindowTk_DeleteAllBindingsTkWmRemoveFromColormapWindowsTkFreeBindingTagsTcl_InterpDeletedTcl_DeleteHashTableTkBindFreeTkFontPkgFreeTkDeleteAllImagesXSyncTk_MakeWindowExistTkDeadAppCmdTcl_UnlinkVarTk_MapWindowTkWmMapWindowXMapWindowXRootWindowTkpMakeWindowTkDoConfigureNotifyXConfigureWindowTkWmAddToColormapWindowsTk_UnmapWindowTkWmUnmapWindowXUnmapWindowTk_ConfigureWindowTk_MoveWindowXMoveWindowTk_ResizeWindowXResizeWindowTk_MoveResizeWindowXMoveResizeWindowTk_SetWindowBorderWidthXSetWindowBorderWidthTk_ChangeWindowAttributesXChangeWindowAttributesTk_SetWindowBackgroundXSetWindowBackgroundTk_SetWindowBackgroundPixmapXSetWindowBackgroundPixmapTk_SetWindowBorderXSetWindowBorderTk_SetWindowBorderPixmapXSetWindowBorderPixmapTk_DefineCursorXDefineCursorTk_UndefineCursorTk_SetWindowColormapXSetWindowColormapTk_SetWindowVisualTk_SetClassTkWmSetClassTkOptionClassChangedTkSetClassProcsTk_IdToWindowTk_DisplayNameTk_RestackWindowTkWmRestackToplevelTk_MainWindowTk_StrictMotifXOpenIMXGetIMValuesXFreeTk_GetNumMainWindowsTcl_ReleaseTcl_PreserveTcl_GetVar2Tcl_DStringInitTcl_DStringAppendtoupperTkCreateFrameTcl_DStringFreeTcl_SplitListTcl_AddErrorInfoTkpGetAppNameTcl_DStringSetLengthTk_ParseArgvXSynchronizeTcl_VarEvalTcl_PkgRequireTcl_SetVar2Tcl_MergeTcl_PkgProvideTkpInitTk_BellCmdTk_BindCmdTk_BindtagsCmdTk_ClipboardCmdTk_DestroyCmdTk_EventCmdTk_FocusCmdTk_FontObjCmdTk_GrabCmdTk_GridCmdTk_ImageCmdTk_LowerCmdTk_OptionCmdTk_PackCmdTk_PlaceCmdTk_RaiseCmdTk_SelectionCmdTk_TkObjCmdTk_TkwaitCmdTk_ChooseColorCmdTk_GetOpenFileCmdTk_GetSaveFileCmdTk_MessageBoxCmdTk_UpdateCmdTk_WinfoObjCmdTk_WmCmdTk_ButtonCmdTk_CanvasCmdTk_CheckbuttonCmdTk_EntryCmdTk_FrameCmdTk_LabelCmdTk_ListboxCmdTk_MenuCmdTk_MenubuttonCmdTk_MessageCmdTk_RadiobuttonCmdTk_ScaleCmdTk_ScrollbarCmdTk_TextCmdTk_ToplevelCmd.sbss.srdata.debug_funcnamesTcl_GetCommandInfoTk_AddOptionTk_GetOptionTcl_TranslateFileNameTcl_OpenFileChannelTcl_SeekTcl_ReadTcl_CloseTcl_PosixErrormemcpyTcl_CreateInterpTcl_DeleteInterpXGetWindowProperty.sdataTcl_FirstHashEntryTcl_NextHashEntryTcl_CancelIdleCallTcl_GetIndexFromObjTcl_WrongNumArgsTkGetDisplayOfTk_GetFontFromObjTk_FreeFontTcl_GetStringFromObjTcl_GetObjResultTcl_AppendStringsToObjTkInitFontAttributesTcl_NewStringObjTcl_ListObjAppendElementTcl_SetIntObjTkpGetFontFamiliesTkCreateNamedFontTk_TextWidthTcl_SetStringObjTkpGetFontFromAttributesTcl_DoWhenIdleTk_GetFontTcl_SetResultTclFreeObjTk_MeasureCharsTkpGetNativeFontTk_NameOfFontTkpDeleteFontTk_FontIdTk_GetFontMetricsTk_PostscriptFontNamestrncasecmpstrcasecmpstrcmpTk_UnderlineCharsXFillRectangleTk_ComputeTextLayoutTk_FreeTextLayoutTk_DrawTextLayoutTk_DrawCharsTk_UnderlineTextLayoutTk_CharBboxTk_PointToCharTk_DistanceToTextLayouthypotTk_IntersectTextLayoutTk_TextLayoutToPostscriptTcl_GetBooleanFromObjTcl_GetIntFromObjTkFindStateNumTkFindStateStringTcl_NewIntObjTcl_ListObjGetElementsstrchrTkParseXLFDmemsettolowerTcl_GetIntreallocXCreateRegionTk_PhotoBlankTk_ConfigureValueTk_PhotoGetImageTk_ImageChangedTk_ConfigureInfoTcl_SetChannelOptionXParseColorTk_FindPhotoTk_PhotoPutZoomedBlockTk_PhotoPutBlockTk_ConfigureWidgetXCreateImageXClipBox_XInitImageFuncPtrsTk_PreserveColormapXVisualIDFromVisualXGetVisualInfoTk_GetColorTk_GetGCXSetRegionXSetClipOriginXCopyAreaXSetClipMaskTcl_DeleteCommandFromTokenXDestroyRegionTk_FreeOptionsTk_NameOfImageTk_DeleteImageXUnionRectWithRegionXIntersectRegionTk_GetPixmapTk_FreePixmapstrtolsscanfpowXAllocColorXFreeColorsTk_FreeColormapTk_FreeGCTk_GetImageMasterDataXPutImageTk_PhotoExpandTk_PhotoGetSizeTk_PhotoSetSize.lit8XLoadQueryFontXListFontsXFreeFontNamesXFreeFontTcl_AppendElementXTextWidthXDrawStringXGetFontPropertyTk_GetAtomNameTcl_GetBooleanTcl_GetDoubleTk_FreeColorTk_FreeBitmapTk_Free3DBorderTk_GetReliefTk_FreeCursorTk_GetJustifyTk_GetAnchorTk_GetCapStyleTk_GetJoinStyleTk_GetPixelsTk_GetScreenMMTk_GetBitmapTk_Get3DBorderTk_GetCursorTcl_PrintDoubleTk_NameOfColorTk_NameOfBitmapTk_NameOf3DBorderTk_NameOfReliefTk_NameOfCursorTk_NameOfJustifyTk_NameOfAnchorTk_NameOfCapStyleTk_NameOfJoinStyleTkpGetBorderTk_Draw3DRectangleTk_3DVerticalBevelTk_3DHorizontalBevelTk_3DBorderColorTk_3DBorderGCTkpGetShadowsTkpFreeBorderTk_SetBackgroundFromBorderTk_Draw3DPolygonXFillPolygonTk_Fill3DRectangleTk_Fill3DPolygonvatanvcosTkpCreateButtontkpButtonProcsTk_CreateEventHandlerTkInvokeButtonTkpDisplayButtonXFlushTcl_SleeptkpButtonConfigSpecsTcl_UntraceVarTk_FreeImageTcl_EventuallyFreeTcl_GetVarTk_GetImageTcl_TraceVarTkButtonWorldChangedTkpComputeButtonGeometryTkCopyAndGlobalEvalTk_RedrawImageTk_SizeOfImagestrtodTk_FreeXIdTcl_CreateTimerHandlerTk_RestrictEventsTkUnixDoOneXEventXCreatePixmapXFreePixmapTkpWindowWasRecentlyDeletedTk_CreateBindingTableTkpInitializeMenuBindingsTk_DeleteBindingTableTk_CreateBindingTkCreateBindingProcedureTk_DeleteBindingTk_GetBindingTk_GetAllBindingsTk_BindEventTcl_DStringGetResultTcl_AllowExceptionsTcl_GlobalEvalTcl_BackgroundErrorTcl_DStringResultTcl_ScanElementTcl_ConvertElementXLookupStringTkKeysymToStringTk_GetVRootGeometryXmbLookupStringXKeysymToKeycodeXKeycodeToKeysymTkStringToKeysymTk_QueueWindowEventTk_GetRootCoordsmemcmpXGetModifierMappingXFreeModifiermapXStringToKeysymXKeysymToStringTkpCmapStressedTk_GetColorByValueTkpGetColorTkpGetColorByValueTk_GCForColorXCreateGCXFreeGCTkpFreeColorTk_CreateErrorHandlerTk_DeleteErrorHandlerXAllocNamedColorXLookupColorXQueryColors.lit4tkPredefBitmapTableXCreateBitmapFromDataXReadBitmapFileTk_DefineBitmapTk_SizeOfBitmapTk_GetBitmapFromDataXDeletePropertyXGrabServerXChangePropertyXUngrabServerXGetWindowAttributesXListHostsTk_SendCmdtkSendSerialTclpGetTimeTkGetInterpNamesTk_InternAtomTcl_DStringAppendElementXInternAtomXGetAtomNameTkpDisplayWarningTkCreateXEventSourceTcl_GetStdChannelTcl_WriteTcl_EvalTk_DeleteEventHandlerTk_CreateGenericHandlerTk_DeleteGenericHandlerTkFocusFilterEventTkFocusKeyEventTkPointerEventXFilterEventTkSelPropProcXRefreshKeyboardMappingXCreateICTkWmProtocolEventProcTkBindEventProcTkSelEventProcTkCurrentTimeTcl_QueueEventTkQueueEventForAllChildrenTk_MainLoopTk_GrabTk_UngrabXUngrabPointerXGrabPointerXQueryPointerXGrabKeyboardXUngrabKeyboardTkGrabStateTkChangeEventWindowTkInOutEventsTkpSyncTcl_ServiceEventTkPositionInTreeTcl_CreateEventSourceTcl_DeleteEventSourceXOpenDisplayTcl_CreateFileHandlerTkpCloseDisplayTcl_DeleteFileHandlerXCloseDisplayXQLengthTcl_SetMaxBlockTimeXNextEventXEventsQueuedsignalXNoOpselectTk_ManageGeometryXStringListToTextPropertyXSetWMNameXSetIconNameXSetTransientForHintXSetCommandXSetWMClientMachineXReparentWindowXAllocClassHintXSetClassHintXWithdrawWindowXGetWMColormapWindowsTk_SetGridXSetWMColormapWindowsXIconifyWindowTk_UnsetGridprintfXQueryTreeXTranslateCoordinatesXGetGeometryTk_GeometryRequestXAllocSizeHintsXSetWMNormalHintsXSetWMHintsTk_CoordsToWindowTk_MoveToplevelWindowXSelectInputXReconfigureWMWindowTkGetPointerCoordsTkMakeMenuWindowTkUnixContainerIdXCreateWindowTkWmFocusToplevelTkUnixSetMenubarTkpGetWrapperWindowTk_SetInternalBorderTk_MaintainGeometryTk_UnmaintainGeometryXGContextFromGCXBellXForceScreenSaverTcl_GetDoubleFromObjTcl_SetDoubleObjTcl_SetBooleanObjTkGetServerInfoTcl_GetLongFromObjTcl_SetLongObjTcl_FreeTcl_AllocTk_GetVisualXCreateColormapTk_GetColormapXFreeColormaptclFocusDebugXSetInputFocusTkpChangeFocusTkpClaimFocusTkpRedirectKeyEventTkpUseWindowTkpMakeContainerXSendEventTkpTestembedCmdTcl_DStringStartSublistTcl_DStringEndSublistXGetInputFocusTkMenuInitTkMenuInitializeDrawingFieldsTkCreateMenuReferencesTkpNewMenuTkMenuEventProcTkNewMenuNameTkSetWindowMenuBarTkGetMenuIndextkMenuEntryConfigSpecsTkPostSubmenuTkActivateMenuEntrytkMenuConfigSpecsTkpPostMenuTkPostTearoffMenuTkInvokeMenuTkpDestroyMenuTkFreeMenuReferencesTkMenuFreeDrawOptionsTkDestroyMenuTkpSetWindowMenuBarTkpDestroyMenuEntryTkMenuEntryFreeDrawOptionsTkMenuConfigureDrawOptionsTkpConfigureMenuEntryTkMenuConfigureEntryDrawOptionsTkEventuallyRecomputeMenuTkGetMenuHashTableTkMenuImageProcTkMenuSelectImageProcTkFindMenuReferencesTcl_StringMatchTkMenuInitializeEntryDrawingFieldsTkpMenuNewEntryTkEventuallyRedrawMenuTkPostCommandTkRecomputeMenuTcl_NewListObjTcl_EvalObjTcl_ListObjLengthTcl_ListObjIndexTcl_ListObjReplaceTkpSetMainMenubarTcl_GetAssocDataTcl_SetAssocDataTkpMenuInitTkpComputeStandardMenuGeometryTkpComputeMenubarGeometryTkpDrawMenuEntryXCopyPlaneTkpMenuNotifyToplevelCreatetkTextNormalUidTkBTreeCreatetkTextCharUidTkTextCreateDInfoTkTextMakeIndexTkTextSetYViewTkTextCreateTagTkTextSetMarkTkTextBindProcTk_CreateSelHandlertkTextDisabledUidtkTextNoneUidtkTextWordUidTkTextYviewCmdTkTextImageCmdTkTextMarkCmdTkTextScanCmdTkTextSeeCmdTkTextTagCmdTkTextWindowCmdTkTextXviewCmdtkBTreeDebugTkTextGetIndexTkTextPrintIndexTkTextIndexForwCharsTkTextIndexCmpTkTextIndexToSegtkTextDebugTkTextCharBboxtkTextCharTypeTkBTreeTagTkBTreeGetTagsTkTextDLineInfoTkTextFreeDInfoTkBTreeDestroyTkTextFreeTagTcl_DeleteTimerHandlerTkTextGetTabsTkTextRedrawTagTkBTreeNumLinesTkBTreeStartSearchTkBTreeCharTaggedTk_OwnSelectionTkTextLostSelectionTkBTreeNextTagTkTextRelayoutWindowTkTextMarkSegToIndexTkTextChangedTkTextRedrawRegionTkBTreeLineIndexTkBTreeInsertCharsTkBTreeDeleteCharsTkTextIndexBackCharsTkBTreeFindLineTkBTreeCharsInLinestrstrTcl_RegExpExecTcl_RegExpRangeTcl_RegExpCompileTkBTreeNextLinetkTextToggleOnTypetkTextToggleOffTypeTkTextInsertDisplayProcTkTextPickCurrentTkScrollWindowTk_DrawFocusHighlightTkTextEventuallyRepickXRectInRegionTk_GetScrollInfoTkTextPixelIndexTkTextCharLayoutProcTkBTreeCheckTkBTreePreviousLineTkBTreeLinkSegmentTkBTreeUnlinkSegmentTkBTreeStartSearchBackTkBTreePrevTagtkTextRightMarkTypetkTextLeftMarkTypeTkTextMarkNameToIndexXEmptyRegionTkTextSegToOffsetTkTextImageIndexTkTextWindowIndexqsortTcl_EofTkComputeAnchorTkDrawInsetFocusHighlightXSetForegroundXFillRectanglesTk_ClipboardClearTk_DeleteSelHandlerTkClipInitTk_ClipboardAppendTkSelInitpendingPtrXSetSelectionOwnerTk_ClearSelectionTk_GetSelectionTkSelDefaultSelectionTkSelGetSelectionTkSelClearSelectionTcl_FreeResultXConvertSelectionTkGetCursorByNameTk_GetCursorFromDataTkCreateCursorFromDataTkFreeCursorXCreateGlyphCursorXLoadFontXCreatePixmapCursorXFreeCursorTk_CanvasEventuallyRedrawTkCanvPostscriptCmdTk_CanvasGetCoordTk_CreateItemTypeTk_GetItemTypestkRectangleTypetkLineTypetkPolygonTypetkImageTypetkOvalTypetkBitmapTypetkWindowTypetkArcTypetkTextTypeTk_CanvasTkwinTk_CanvasDrawableCoordsTk_CanvasSetStippleOriginXFillArcXSetTSOriginXDrawRectangleXDrawArcTkOvalToPointTkOvalToAreaTk_CanvasPsYTk_CanvasPsColorTk_CanvasPsStippleTk_CanvasTagsParseProcTk_CanvasTagsPrintProcTkLineToPointTkLineToAreaTkThickPolyLineToAreaTkGetButtPointsTkPolygonToAreaTkGetMiterPointsTkPolygonToPointTkIncludePointTkBezierScreenPointsTkBezierPointsTkMakeBezierCurveTkMakeBezierPostscriptflooratan2sin__dcisTk_CanvasWindowCoordsXDrawLinesTkFillPolygonTk_CanvasPsPathTk_CanvasGetTextInfoTk_CanvasPsFontTcl_GetChannelgetuidgetpwuidendpwenttimectimeTkGetPrologTk_CanvasPsBitmapXGetImageTcl_JoinPathTkInstallFrameMenuXDrawLineTkpCreateScaleTkpSetScaleValueTkpScaleElementTkpValueToPixelTkpPixelToValueTkpDestroyScaleTkRoundToResolutionTkEventuallyRedrawScalelogTkpDisplayScaleTkpCreateMenuButtontkpMenubuttonClassTkMenuButtonWorldChangedTkpComputeMenuButtonGeometryTkpDisplayMenuButtonTkpDestroyMenuButtonXSetErrorHandlerTkGetBitmapDataTkpCreateScrollbartkpScrollbarProcsTkpComputeScrollbarGeometryTkScrollbarEventuallyRedrawTkpScrollbarPositiontkpScrollbarConfigSpecsTkpConfigureScrollbarTkScrollbarEventProcTkpDestroyScrollbarTkpDisplayScrollbarTcl_FindExecutableisattyTcl_EvalFileTcl_ExitTcl_SourceRCFileTcl_FlushTcl_CreateChannelHandlerTcl_GetsTcl_CommandCompleteTcl_RecordAndEvalputsTcl_DeleteChannelHandlertclFreeObjListtclEmptyStringRepTcl_InvalidateStringReptclListTypeTclAllocateFreeObjectsTcl_DbNewListObjTcl_SetListObjTcl_ListObjAppendListTclFindElementTclCopyAndCollapseTcl_ScanCountedElementTcl_ConvertCountedElementTcl_SetErrnoTcl_SetStdChannelTclGetDefaultStdChannelTcl_RegisterChannelTcl_CreateCloseHandlerTcl_DeleteCloseHandlerTcl_UnregisterChannelTcl_CreateChannelTcl_GetChannelModeTcl_GetChannelNameTcl_GetChannelTypeTcl_GetChannelHandleTcl_GetChannelInstanceDataTcl_GetsObjTcl_SetObjLengthTcl_UngetsTcl_TellTcl_InputBufferedTcl_InputBlockedTcl_SetChannelBufferSizeTcl_GetChannelBufferSizeTcl_BadChannelOptionTcl_GetChannelOptionTclFormatIntTcl_NotifyChannelTcl_FileEventCmdTclTestChannelCmdTclTestChannelEventCmdTclCopyChannelTcl_NewObjTcl_DuplicateObjTcl_SetObjResultTcl_RegisterObjTypetclBooleanTypetclDoubleTypetclIntTypetclStringTypetclByteCodeTypeTclFinalizeCompExecEnvTclFinalizeExecEnvTcl_AppendAllObjTypesTcl_GetObjTypeTcl_ConvertToTypeTcl_DbNewObjTcl_NewBooleanObjTcl_DbNewBooleanObjTcl_AppendToObjTcl_NewDoubleObjTcl_DbNewDoubleObjerrnoTclExprFloatErrorTcl_SetErrorCodeTcl_NewLongObjTcl_DbNewLongObjTcl_DbIncrRefCountTcl_DbDecrRefCountTcl_DbIsShared__new_cfgetospeed__new_cfsetospeed__new_cfsetispeed__new_tcgetattr__new_tcsetattrfcntlreadwriteTclInExitcloselseekTclGetOpenModeopenTcl_MakeFileChannelTclUnixWaitForFilerecvsendinet_ntoagethostbyaddrgetpeernamegetsocknamesocketTclSockMinimumBufferssetsockoptbindlistenconnectinet_addrgethostbynameTcl_OpenTcpClientTcl_MakeTcpClientChannelTcl_OpenTcpServeracceptTcl_GetOpenFilefdopenstatTclUpdateReturnInfoTcl_GetErrnoTcl_ErrnoMsgTcl_ErrnoIdTclServiceIdleTcl_AfterObjCmdTcl_ConcatObjTcl_SetCommandInfoTclLookupVarTcl_FindNamespaceVarTclGetNamespaceForQualNameTcl_ObjGetVar2TclGetIndexedScalarTclGetElementOfIndexedArrayTcl_SetCmdTcl_ObjSetVar2TclSetIndexedScalarTclSetElementOfIndexedArrayTclIncrVar2Tcl_AddObjErrorInfoTclIncrIndexedScalarTclIncrElementOfIndexedArrayTcl_UnsetVarTcl_UnsetVar2Tcl_TraceVar2Tcl_UntraceVar2Tcl_VarTraceInfoTcl_VarTraceInfo2Tcl_UnsetObjCmdTcl_AppendObjCmdTcl_LappendObjCmdTcl_ArrayObjCmdTcl_UpVarTclGetFrameTcl_UpVar2Tcl_GetVariableFullNameTcl_GlobalObjCmdTcl_VariableObjCmdTcl_UpvarObjCmdTclDeleteVarsTcl_GetCurrentNamespaceTclDeleteCompiledLocalVarsTcl_SetTimerTcl_WaitForEventTclInitNamespacesTcl_CreateNamespaceTclCreateExecEnvTclInvokeObjectCommandTclInvokeStringCommandTclSetupEnvTclInterpInitTclPlatformInitTclPrecTraceProcTclHideUnsafeCommandsTcl_CallWhenDeletedTcl_DontCallWhenDeletedTcl_DeleteAssocDataTclTeardownNamespaceTcl_DeleteNamespaceTclFreePackageInfoTclDeleteExecEnvTclCleanupCommandTcl_FindCommandTcl_ExposeCommandTclResetShadowedCmdRefsTclRenameCommandTclPreventAliasLoopTcl_GetCommandNameTcl_GetCommandFullNameTcl_DeleteCommandTclExecuteByteCodeTcl_AsyncReadyTcl_AsyncInvokeTclCleanupByteCodeTcl_ExprLongTcl_ExprObjTcl_ExprDoubleTcl_ExprBooleanTcl_ExprLongObjTcl_ExprDoubleObjTcl_ExprBooleanObjTclInvokeTclObjInvokeTclGlobalInvokeTclObjInvokeGlobalTcl_ExprStringTclInitCompileEnvTclCompileExprTclFreeCompileEnvTclExpandCodeArrayTclInitByteCodeObjtclTraceCompileTclObjIndexForStringTclPrintByteCodeObjTcl_CreateTraceTcl_DeleteTraceTcl_GlobalEvalObjTcl_SetRecursionLimitTcl_BinaryObjCmdTcl_BreakCmdTclCompileBreakCmdTcl_CaseObjCmdTcl_CatchObjCmdTclCompileCatchCmdTcl_ClockObjCmdTcl_ConcatObjCmdTcl_ContinueCmdTclCompileContinueCmdTcl_ErrorObjCmdTcl_EvalObjCmdTcl_ExitObjCmdTcl_ExprObjCmdTclCompileExprCmdTcl_FcopyObjCmdTcl_ForCmdTclCompileForCmdTcl_ForeachObjCmdTclCompileForeachCmdTcl_FormatObjCmdTcl_IfCmdTclCompileIfCmdTcl_IncrCmdTclCompileIncrCmdTcl_InfoObjCmdTcl_InterpObjCmdTcl_JoinObjCmdTcl_LindexObjCmdTcl_LinsertObjCmdTcl_ListObjCmdTcl_LlengthObjCmdTcl_LoadCmdTcl_LrangeObjCmdTcl_LreplaceObjCmdTcl_LsearchObjCmdTcl_LsortObjCmdTcl_NamespaceObjCmdTcl_PackageCmdTcl_ProcObjCmdTcl_RegexpCmdTcl_RegsubCmdTcl_RenameObjCmdTcl_ReturnObjCmdTcl_ScanCmdTclCompileSetCmdTcl_SplitObjCmdTcl_StringObjCmdTcl_SubstCmdTcl_SwitchObjCmdTcl_TraceCmdTcl_UplevelObjCmdTcl_WhileCmdTclCompileWhileCmdTcl_CdObjCmdTcl_CloseObjCmdTcl_EofObjCmdTcl_FblockedObjCmdTcl_FconfigureCmdTcl_FileObjCmdTcl_FlushObjCmdTcl_GetsObjCmdTcl_GlobCmdTcl_OpenCmdTcl_PidObjCmdTcl_PutsObjCmdTcl_PwdCmdTcl_ReadObjCmdTcl_SeekCmdTcl_SocketCmdTcl_TellCmdTcl_TimeObjCmdTcl_UpdateCmdTcl_VwaitCmdTcl_ExecCmdTcl_SourceObjCmdTclPrintSourceTclPrintInstructioninstructionTableTclCompileStringtclTypeTableTcl_BackslashTclCompileQuotestclCmdNameTypeTclLooksLikeIntTclGetLongTclCompileDollarVarTclEmitForwardJumpTclFixupForwardJumpTclCreateAuxDataTclInitJumpFixupArrayTclFreeJumpFixupArrayTclExpandJumpFixupArrayTclWordEndTcl_OpenCommandChannelTclGetAndDetachPidsTclSockGetPortTclRegExecTclRegCompTcl_GetPathTypetclPlatformTcl_SplitPathTclGetExtensionTclGetUserHomeTclGetEnvTclDoGlobstrpbrkTclMatchFilesaccessTclChdirTclFileAttrsCmdTclFileRenameCmdTclFileMakeDirsCmdTclFileDeleteCmdTclFileCopyCmdTclpListVolumesgeteuidlstatreadlinkTclGetCwdTclGetIntForIndexTcl_ParseVarTcl_RegExpMatchtclTraceExecfflushTcl_GetCommandFromObjTclGetExceptionRangeForPcbuiltinFuncTabletcl_MathInProgressTclpGetClicksacosasinatanceilcoscoshexpfmodlog10sinhsqrttantanhtclMatherrPtrtclNsNameTypeTcl_GetGlobalNamespaceTcl_PushCallFrameTcl_PopCallFrameTcl_ExportTcl_AppendExportListTcl_ImportTcl_ForgetImportTclGetOriginalCommandTcl_FindNamespaceTclRegErrorstrcspnTclGetRegErrorTcl_DeleteEventsTcl_GetServiceModeTcl_SetServiceModeTcl_ServiceAllTclFindProcTcl_GetHostNameTclGetLoadedPackagestclExecutableNameTclIsProcchdirgetcwdgetenvgetpwnamopendirreaddirclosedirTcl_GetSlaveTclGuessPackageNameTclLoadFileTcl_ConcatTcl_GetStringResultTclNeedSpaceTcl_SetObjErrorCodeTcl_MakeSafeTcl_GetInterpPathTcl_CreateSlaveTcl_GetMasterTcl_CreateAliasTcl_CreateAliasObjTcl_GetAliasTcl_GetAliasObjTclpMakeFileTclpOpenFileTclpCreateTempFiletmpnamunlinkTclpCreatePipepipeTclpCloseFileTclpCreateProcessforkTcl_WaitPiddup2_exitexecvpTclpCreateCommandChannelTcl_DetachPidsTcl_ReapDetachedProcsTclCleanupChildrenwaitpidgetpidTcl_UpdateLinkedVarTcl_DeleteExitHandlerTcl_FinalizeTclFinalizeEnvironmenttclMemDumpFileNameTclObjInterpProcTcl_AsyncCreateTcl_AsyncMarkTcl_AsyncDeletetclIndexTypeTclParseQuotesTclParseNestedCmdTclParseBracesTclExpandParseValueTclObjCommandCompleteTcl_SetPanicProcpanicProcabortTclpCreateDirectoryTclpDeleteFileTclpRemoveDirectoryTclpRenameFileTclpCopyFileTclpCopyDirectorytclpFileAttrProcstclpFileAttrStringsrenamemknodmkfifosymlinkumaskmkdirrmdirchmodutimegetgrgidendgrentgetgrnamchownTcl_SignalMsgTcl_SignalIdTclCreatePipelinestrerrorTcl_DbNewStringObjTcl_DbCkallocTcl_ReallocTcl_DbCkreallocTcl_DbCkfreeTcl_InitMemoryTcl_DumpActiveMemoryTcl_ValidateAllMemoryTcl_HashStatsunameTclpGetSecondsBSDgettimeofdayTclpGetTimeZonetimezonetzsetgetservbynamegetsockoptTclSetEnvTcl_PutEnvTclUnsetEnvTcl_RecordAndEvalObjTcl_CreateMathFuncTclGetDategmtimestrftimelocaltimeTclDatelvalTclDateparseTclDatechkTclDatepactTclDateactTclDateexcaTclDatevalTclDatepvTclDatenerrsTclDatestateTclDatecharTclDateerrflagTclDatevTclDatetmpTclDatesTclDatepsTclDatepgoTclDatedefTclDater2TclDater1TclDate_TclDatevTclDate_TclDatesTclDatedebuglibX11.so.1sgi1.0libm.sosgi1.0default_display_messagevsentfilefpdatafpscntlistfpindexfpsOpenDBkeyindexfprevkeyindexfpvidxfilefpsaflagfnflagwnresultsfrflagsensefprewinddo_tracegetpospartnamestraceptrs_dsfree_synsframetextfgetsatolstrstr_initToLowerCaselast_bin_search_offset__eprintfstrtokstrtolowerin_wnbin_searchpartcharsGetKeyForOffsetfindtheinfo_dsread_synsetgetsstypegetptrtypeGetTagcntlexfilesfseekread_indexstrstr_getnextwngrepparse_synsetgetindexindex_lookupfree_synsetparse_indexftellfree_indexstrsubstmorphinitGetSenseIndexfcloseGetOffsetForKeyFreeSenseIndexGetPolyCountGetWNSenseGetSynsetForSenseFmtSynsetre_morphinitGetWNStrGetPOSwnreleaseGetDataOffsetStrToPosGetWORDstrdupptrtypfopenWNSnsToStrSetSearchdirGetValidIndexPointercntwordsadjclass__semputccopyfilereplace_linetmpfile__us_rsthread_stdioinsert_line__flsbufgetcmorphwordstrncat__register_frame_table__register_frame_info_table__frame_state_for__deregister_frame__register_framelibc.so.1sgi1.0__do_global_ctors_endend_edataedata_etextetext__elf_header_ftextftext_fdatafdata_fbssfbss__program_header_table__dso_displacement<1wv#3~y(ApeI|'%{GeJF&bKX B XY{6&~b)dMkJe -ZAr%+QV^_>n7*hbEFqR);\PE!mz>[hcdWYFh8?HFP\U:5DR`LWSQT) c{W_52ZM'DpI&kcb EOM!~-U)goQ"G$7 X5$hmk2"%. R3LnX#ClD*)/3=y1\p8kV"6Jos]F+6GrIB :?vD&`<tY(_lpB]0u]nL-s+$x nE55gB7ajt9~HTKJ.jd ; G6$$?(^[fw#0,T;q`G,ov.V@#D::rHOq|0+ WAfdU=PnBCS}9}NmacQroE;_' gN*4[<^O.Oc8v([L?s! *W8 @u7U(1;z@>Z[l!ZP\V t~H{6SAlSfl8&-j4_]3I/JiP2=u'<;yNw>VT{hL^QEz#LC5vC,  yX9`  >wu  a4"W smNYY  ib6, Z 7^m %SKCf/KT@Ap<Z+yx|xCe@}f>okj{gi nUjv|B*odRr}1.^Q"\!}='O#Dz3+~ "G8Ifq/4w1h0:0m[4|Kxgi%3iOkXatM927J .$]T}?U /R@xVx&N)Ku`?IlPdc2r/4*bH !azie  (q,s-09<=NMy,SMajtt=z'pFu]H2:gR %A1Yw\_-sq9`e|s`=gN O 6b3  LP4;-  XRH`P(pLHXXDXv4XX&XQ&3 4 40W` UZ@ \d =]`d ^04A` APB \Eyx]zd ^p`$0/{P0M0_H3yH6 B46 F7 e7 q 8x 8 @09; 9M Рh:$ :: @:I L:[ 4:z P4: 4: 4;  ; 0H;1 < 0< @ < ,`? ?- `@ p@ @@ B ذB1 ڠBP ހB` pBr `B PB C` Cp C L`L0LLԀ`L M`P`MjMx@M M lN  PN N,N9lO;'OO4OQPxOQ,ORP ]@P,n`pPBnQư4Q͐Q \Q΀QP8QϐQϠQϰRRxUcDTPU8<VtV$|VxΠV`V,W|Vm8`VQشXVA W@PWiD<WXWXWDWX PX> X7 X^Xe%PK^hW${xXkXqX1X*O:lS@@7Q`X&QX!Q mp@ m nP n@ Mh 0  P8 ,8 V8 8 5   p 50 6 | 78 @` AA` qC DL G| K M *ipD 0 Z  p1 p-@G 5 }E `1a,1e| J 8 `8 e`   { =P  V08 b f  P > 9* = T8> u@> v|> x@? }0 ?P X?a p?t C XtC Z@ lD< ctD e0 $D n` D vp E E+ TF~ @ F G אGl @G| G G G G `GK pG* PH* @G8 PdG PG D G 8C .hC /0C 3xG  5PD 6@\D, 6hDR 7pDb 8<Dq 9D :TG] <tD RD T tD _P (G iF4 j@4FB p\FP xFa yXFr ~ PH6 PF pF ` F P@F H F @F `dFEEܰE=ް E]El`E}EhEEEtE PxE F, E= C|EL`G#H6dH8\F%9p`FB5X\D 8@@T$S;XS=XO,W8H<1,"K P0PK<N$KKKKK   !U0 M6 KzLMN@LKJ@J@J*h"!H!0gt!K0<KdKN8go~L~%PK$h5 ;( LFKT/6\Bdgxl<@nVp $:R8RcTV3WMX 8V:d;8;(T<;8U&<p< ,X4"P,l",",#`,#p,#v,$,X$1,$M- $- $-4(-H.-\.C-p.-.-/s-D/-d/-/-d0-1.15.$1D.8x2.L 2.`3 .t3'.30.P39.3>.@3b.4.5/6N/;@/(L;R/<P;d/PP;v/d8;/x4;/;/H;/H</<&/<2/] tp ǐHS)T&)d.`t?@B LyBppBIPJ0iL@lPM7YTiop@xdq4su ou0u@v 0wP8wyz~hG`4P*(@@" 190xp8+pxL@PxHjH ;v4GÀnŰ4{P@PƐXpP  p3PD Rϰpа`d  HW`44|' `8 DG Z#@&*,T-./0;0@1 2:@8W:>p?p@0APtnTp ^PTqrTuP 1v v1wp(/xzplxi $hP6PQp]le`@`0d_0`|lX{\P|G`   0!l!<|h"\ "nt D`,("" P""$"## &$ &"'#!(\#6(p#J+`0409 <?#g,hP$ $"@P(tu @$l $ |$y$kp"l$\0%E&>I%XP$%e'f`h%^oP|%lq&t%,u'3v0d&vl%xH%x$'Xy,&(y@&tz &z&}&PT'd' 'h%N P' p\%l%@\%CP<&&`&t'{0&L@P(%4(pP((QP(P(E`+^Ӱ* (*,`++ P(+ !+$P)&)+0l). )3)9p-/B0*oC*F0(U,*VP+X+\,`@,sad-bb@X+c-vd-epx*e0+)n`-p@+rr0d-t+<xP*z0-U~+`,(())/+p@-l,,)*R`P.(**\*CP*.,<).1Ѐ). )`)`P*0)=8, 0(4V %.a(,)4-*.Q-.8.P.2 X.3`.<)L=D.>+N?/Ap/BPOVpx.W/PY/([D/>_a e sy~@/`</`/`0 1`112)2 P1M 1[2:2IT2^p2m02021 H0_@0_P2` 0;`x1apD2a0'`1u43@p3P1P1h`23D  T۰@4  &3 '3 )43 *44& 43 6d3 9`@3 :3 ;# <` <T4] H ,46 N44 O4 S4v ShH ^ 2 4 @5~ 5 ݰ4 0p5 ޠ5 p5 t5h 5; @ ' @6 C 5 F Gp' I' I|' JP L7^ c`  dP$7 ed7 k l7 l3 mp7 o8 q 8 q08+ q@T8@ qj xP zP5 @$a 6 ,8[ HX 8 @T.I X8 8 08 p8 8 @, p X9 6 06S @,9d 9 T9 p9s l6 \^ 0t9~ 0P 6 p\:h t#  @T: x# # ' p @ x: @p# # D 0T; <  <  7p `; !P@; $5 ) <7Q ,t ,xR -* /|6 2 3=  4=/ 50=` @  I<  J = M= Pp= Q U@  V0= Z= a4>  e >& i@>F jt>[ lP|>x m<> nL q`H> q r`H> rd> t H> tp?8 ? ? ?  H d n P?   @ (4 @(#   XD PAH @\  / p@1 P8@ ǐXAr =M  ΰA `HA ϰA Рd ,A& @H& Ґ' @lB@ ܠB `B PPB $B% d  @4>2  n 0 PC `P CL HV HG pB B B C pH{ !@H >H K 8H `TC7 C ƐI I. IZ @ID @H 0,I  `$I I  3l . `I 0J  $ @  A `L: A PK.A:[@K]0h?`H?a0 KaPKa`HKb?c@gP0@hLl`Lo 4L/p`HL:tLKvpD=wLLa~A8~H=m0HAZndH dPIIlLs@L`  %ϐ'PҀ \JGJ5J#J2$  '  z( A:`<GLI` LpL MN6OH7 V0 WY87 Z [@77[ ^=?b('HedPhP9k el`oUpx/dsu:wp,axT,B{P,Q| 4J|`l | |  ?  lPq $$`8@rpM`9 @ HPJpdA@`M`Mp4@T p$ ` M_ 0NI0TNVNc0PNN pNlNpIHN"|$l,&`-p@4\55HOe5;6p?!@LDP|MD0OG<PARAS@S`VOX0O\0P_Ir`hJj 6(m|TnJ`o8Jp08JqsJv(JPPPXPwPPc0PPJPLNOOQd PI}P=p= QW°<QIŠ 8g : @v`#0\#4p00DҀXn4@b<58R4KlTR6@`TMl$M$DIp(<9@HRn0LRJOr@L6<Rp<BR6|RQRS (U_U`UdLUrfhUg< TrxUrVt U| dT$E@]WǜU-TlTXVTUlTU~ʰV8Vl\VdVҸV,֘|UUS V8T,DUpxUU>t(W7,V"VmTWLPWTPU hM x%@%@@*~ , , - -@  "  0o'P0'P0)P0*P0+P0-@P00`P05P4J> 0FPPF5PGJ 6O9O(9O@9OXHjV(H[9]pKH^HbpKbOdPPdhPdx9dSjSmjSq(S q@StSu,SuSvpRwSwTx_xTyxxTxxx0xTNxT3y(TEy(Ty,T;y0TUy4T`y8T'y<Tny@yDyHVyUzVzT{XUI{pT{U| d(%J%%t%%*(4y*$?,(,@)`,D)r,H(,L),P*c,T*,X.,\4- 6l16{1C'60I64K68KY6<M :hPS:pR;S#;S.@DS@HSE@LSv@PS8@TS^@XSR@\ QPFQpTQ8_`,"a(%aL&ap'`)_*^2_ ?_A_xB_0K`PaT`v_Tw`x@{d{`P`t(? ( o_ dt?554K]J5Y50x50tI'$ хm]j:l4 cHb} \F % U S 1 _`9'yaa s 4us* J] vd% 7>+<yU* tJc*tt,yL] &L"br ?   sx(Z?ll*& FV  cC3 @Rj . Sj3rR"NE{E7aE3 "l)c 'K D9c) xcy"vk%pF {D >bm4 (p2 =y&H:^5 w |uU ȂulBl\\l62hOb .eɣɣk[ <57wOtlD\D K$/@t YUpDK@4%W$d aet&4 Nȹ 9v~R;T9k|It)t 9t⮳+ՔzZyA dc c8 n"D 9v"it $ T ,T $4`,T} q o  Zt9T V PD|$e{1$|h \t t bf(x4 ,D2t4d6 ۤ{ua:ˤ a4d+ {!{& {${#j єx$m "$ Όt D0 J|C Ӿ h0˔?t |D |T s  |4*e5 6 Yt ,t X(| 4bg5cf  0N rc Ai4lAbOYT#[z~HU.sZ@|+ Q  ܬV,KxzcrT<sy iWty `<sN <:@jc  e\!h b] ݲF~  jdyUwg &R q #HB J083Sص  J  lvlO e `Dmft FU\ص6~j6lܳf[ +Ur _]C lmm,4nm6bhyt e`R@QUpd iT|8xg #h yY K\3#E~BP "ijb Do'̓#Of V%  \ ^D %oj c ? :3 Y yj-w #W"Cu s |͔tg_y E8s Ae=]c Gy4 (D +^q BTVCGns'# 3wrD9wֹ3? Die^^U Ҳ;5mœ   \U4 nc$e cOc`%%v% c Rϊ (U* XdmB%3I9 4>hCIW2Op.dG \Q 23 +6 PFt PE*vH0_E7Y1 u AI\eX T [  74wD)6 c սU7K/ u"#F QH( o $ t5 ڣ ݳy4 yDedc E{eyd 4Z[6 4 S  2kZ Ս ] l ݦ" ݪY~fn   .9=@ls r# "Bl# q B wF\# }q }*/A#1 T S  A `C  0&C#Nt< H` %y  o8 #g  (f aUPEh Yj% `h<n,B X / [P9%" LB K3  {ˢoq mM 7 .ܪ .,{c_ I|yh [Uu\|u\ 4 P<ŭ7|  #ٯA:5N=f8 $ #  $ $ < 5W ddezC +, p p6r 'dI/5“ O 3]Z /8 '- &- C۔+ ގ:gg(:  <͢ jڕd"l  e  & ""("LU 5L7EojTO6 jbsp 6 jr0 俹iR  6BkR ӈ2 8]lrT5oCW U d  0Rr2j h[]sΊ! ! ¡ j* ~t  ô9D ɇTlol/m ,e`% ̤ #  zι o ׺  ? n<c$I3Cs^CeFke! ~JJgJA G v)B1 ; 2Ԭ f0 3 "iLK1 yJe\, g@%SJ u[u~eU% ܴ}ܴ 7Qthd I%tQ d[Ih3&t ΠG^PPd :UB@@F4 .tT t(U:Um3  Ց_  3 c @u';tlĕ z c y t3DCu:Ϛ h.  U jTw$ 9T %@  kr$vF4 PY xr)}D kD˅ oZ0s%4׈  686 = 4 (EVR%u : dC| u :4g@0Wb #̤  (ك# ΏD8nCh͔Em"T 3^v j@ͪ i  Aa Iuui Ƴ.-v& 8  ?'W dd]7  } q)8 # UU  _wYJq`5t $ĮA xE uյ"oJWB +DekJ#Q l3  *X Ldt t Zx  s 䝴n fR  |ܷc  q$ $ܕCW @Kt t ^Q Yʅ ndd oS,5) x 05C B: ) +_Eҵ +U ϕ}~Y}% `%MUU *0ڕ#d U 8s ϋ!U^*uEe% s% 1U g%S+ c fn1  l  wjww%ww  ͮ Y'f‚ }s ś 0MP `~у q { C "SS x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4 x% 4 x% 4 x% 4 x% 4 x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4x% 4 x% 4!x% 4"x% 4#x% 4$x% 4%x% 4&x% 4'x% 4(x% 4)x% 4*x% 4+x% 4,x% 4-x% 4.x% 4/x% 40x% 41x% 42x% 43x% 44x% 45x% 46x% 47x% 48x% 49x% 4:x% 4;'$$'`%<g-<8-炼$%0!<<-!&<<-!<H %@TD4@D S@ %N, U %N$ $X`@`(%@(%(8%@% 𨌄ߧ`p$`('8%@% 𨌄t ($  (<'p0h$BƐ "!߼h'`(0pL t߿p߼h'`،@%4 $ߩ`-\, +*)' ޜ߿p߼h'p U`ߤ`߿pь'<0($BŐ% "!߼(߰0'P ܎0c`܎8 @(%߿8@[@(%@ Y 8 % @(%d' $4P ߿80T00 .߼(߰0'P8 < %@(%$@JB$@J@C0c T`B$$ '$` ߿8  |ώ %$@$ WԮ߿8Ǝ  %߿848 U ߿8B'p<$BÐ0h00 "!`߼h'pP 0߿p߼h'`䌅@%$0$ ߦ`0! ߿p߼h'$\ ' ޜ߿p'<0$B %%"!% 2(C82"A<@2(C@2"A D@2(`CHtt $߿ @8%  0% ߱ % W߲߿  ߰T@%߱6RT߲߰߼'P<8%'H%<$!%8@ !! 0%@(%  W %߿߰T4c4BT߰߼'@D8%'H%<$!%@@ !! 0%@(%  W %߿߰T4c4B T߰߼'@D@H%p%<X%'`%<$!p%8!!@%`8%0%(%  W %߿߰T4c4BT߰߼'P'Ќ0%<$!%H !!(%  W %߿߰T4c4BT߰߼'08%P%H%0<'1($B@ "!CX1"A\@1(C`1" Ad@1( Ch1"@Al@1(Cp1"At@1( Cx1"0A@1($C|1"(A@1( ,C1"@4A@8CE 0% D߿H @%H߼'0@%0%<'$$!\ !! (% ߿C$4B߼' @%0%<'$$!X !! (% ߿C$4B߼' @%0%<'$$!d !! (% ߿C$4B߼' @%0%<'$$!` !! (% ߿C$4B߼' @%<'0%$!0 !!  (% ߿4B@߼' <'$!!! Wt(%߿߼' 'Ќ0%<$!%!!(% 0B@ ߿߼߰'04c |  %߿4 %5) 1" @5!$'$!\ 0%8<@ D$H(P<`$B "!h,' ޜ0߿h߼`'hL,<'$!!!,% %0c`4X  % a, %߿߰߼'0(<'$Bp"!98 $$ ߿@@ % ߼'@tߤ@%'xߦ $߿%߼'@<'$c#!߱8t@ %t@%$Ў $x߿0߼ $߰(߲'`߰(`'9 fD`߿0߼ %߰(߲'`"'9@ % a@8%A߿0߼ $߰(߲'`$Pߤ [̎߿0߼ %߰(߲'`ߦ@ % X$@߿0߼ $߰(߲'`@ % \ @߿0B߼ %߰(߲'`'Ќ$ <$B%))"!P0" ! %@CAP! P@DP!̀$$$$I%)'%D $ %"$C"HC$!H $$"$@8% 0%H("P $`'9 fD(`߿߼߰'0 %e$bHI$ <X%$cPM#!#,`P%E$ @%kc%J$k #0d! @!p@p! @!p p!!)$%$ MH %% )%^b$%pDbHDblDbD$ceb$@(%`0%H l$+@%$%b(10!$ e,9E8!$ Gf0E!$B g4 )(!$ b810!$ e<9E8!$ Gf@E!$B gD)(!$ `E% ` %$HMl'( % %$w@%:$sE$uQ$i% %0% '߿߰($ (Ge`@t߱ '@ttH% 0%t%$ߤ $߿$߰(߱ '@t % %ߦ $@Տ߰(߿$P߱ '@t %@0% $P@߿$߰(߱ '@t %ߦ $`@߿$(߰(߱ '@t %ߦ $p@߿$<߰(߱ '@'(8X0$ ! %%P$:$ @$\$#H$ $  $@ %&& [ߧ$ !$$&V$TDdP%(% %J&D VDTd2&&D$ %JD$@$&$&`P%D0%%J&DD2dR&&D d&r&&&&tߤ0% $߰0߱(߲X߳Pߴ@ߵ ߿߶H$߷8߾'tߤ0% $P߰0߱(߲X߳Pߴ@ߵ ߿߶H$߷8߾'߰0߱(߲X߳Pߴ@ߵ ߿߶H%߷8߾'tߤ0% $0߰0߱(߲X߳Pߴ@ߵ ߿߶H$߷8߾'' %@ t %t8%$ $p߿$߰'@p %ߥ F'@߿$߰'@ %@(%8%  '@8% 8'ߢ@3\$(% $@ %\@@%(%ߤ $0%ߢ@M $DP@(%ߤ@H% xߦ@-D % ߥ߫ߪߧ'9ߥ %KP!`0% b4@ ߤ߿ߢ߰'@ h % ( %@@% %tH%' ߦ $߿$߰'@ ( %@@% %tH%'(ߦ $D % ߥ߿$߰'@ ( %@@% %tH%'(ߦ $D % ߥ߿$߰'@'%! $ $E E߿@^߾' '"* % $B$c%߰'0B !! $ )H!I9H8!$ G& $D  1  %߰ߥ߿'(P$`w%ߤP <$0-$$ $'8#%@*%#$c C0f'8#A!XgX!J! XjX!@G$B$@%(U%dH $"C"ܬC$! $"@8% 0%%!&%*!%FG(I&H!%) F(I'H!%) G ( I&H!%) F(I'H!%) G(I&H!%) F(I'H!%) G(I&H!%) ( 10!$ ߦP$ %ì0"8*&s@8H!ߧP! %# #% ()  cB)| $cb@$`%FN@%H( $&B&0'߱P6 (%14XuP!0JwX!a@'%B  0&B!@% %@C%(%&@C  e`% 1 (%& (% e`%& f&#J!$B ߱Pʎ10 e`%&߰߱߳0ߴ@ߵ߶ ߷8߾߿(߲P߲H'pc&%B(!(  !  @%@ %00! 0 8P%߰߿(@!S'9( d(%ߥP ߿(ʌ$@ߦPG((9%%$(#'" (*)$ $ `$f f$F F@@%F F%& & % $ ߤP('9@(% e`0 ߿('9( f %߿( %H$G'0$%8( 0(%%$ &%&0D! % &R 0 AC&1&C@߱8ߵ0߰(ߴ ߿߲߳'P% &12& 0` % ((0 %&1`$`$ (% !% č00! (% !% č(00!Ӭ`$ % ! (% č(߿(!ߥ' %( &s$ c`% <"`'9@%@ % fl%` % $߱߿ ߳('@ $( $$!%&s$" $ c`%ߡߥ$!"ߢe!$"`$%ଠ,$($Ƭ '%  %!&& 0!  fD%&ߵ ߰ߴ  %߿߱'@'P H@$ H%8%$<' '$'05', '( $@$  t'9`ߤH$<ߥ@ c$߿P'p# $(쏤 ߤH'9ߥ@$< b4 8 ߿Pߢ8'p<'$!@!! $p@%$ 3@ %$ 3&4߼lߢ߿hPH߰'0'H!< $B~0 "!tt $ 4L %'&$4 4@(8D  %' 4@%@߲8 4Lߤ&l (% $  % %߱߿0߰(߼ 'P'8PH<(($c}X%%BH#! @T'|@%'  %$( $$ @߿߼P$߰X߱H'X %t0%$ $߿߼P$߰X߱H't,H$c.C!Cߡ8ߨ8`(! %ߥ8'& $@Fߨ8)Gߩ8"H#)) C % jԏ@ߡ8(! 0%ߦ00! ߰'9 % s|&$ k %߿߼P%߰X߱H' }(% 8, @ %ߤ@`@(% $4@@8% hߨ8| % (߰Џt@ %@%t0%$p 2$`߿߼P$߰X߱H'ߨ8)$ s (%ߡ@$ $!40ߣ8(c`ߨ8)ߩ8ߡ@%)$!40 H% %ߥ8'& $@ߨ8$ @# WX %t0%$ $߿߼P$߰X߱H' %ߥ8'& $@ߨ8$ @# X %t0%$ $߿߼P$߰X߱H' %ߥ8'& $@ߨ8)ߩ8"H#))  % jԏ@%@ %ߡ8$#uT %ߥ'@%|'0($((!$@ ، @珥$ kߤ߿߼P$߰X߱H' iX %'80% $߿߼P$߰X߱H'$!'(' ߦ, '߹@9`@(% ߤ0@ߡ$ '` rx'(ߧ  %ߦ8'('90#8 r8!@߿߼P$߰X߱H' 4菙 ߤߡߣ$c0!#ߤ̀(% 8, @ %߹@9`(@(% ߤ0@:@ % A $C$  -ߡ8$#؎ '9 % s|%e߿ߤ@' 4$4@߿OX %t0%$ $ ߿߼P$߰X߱H'X %t0%$ $ ߿߼P$߰X߱H'| ( %t@ %t@%$pߦ( 2$`߿߼P$߰X߱H' % jԏ@߿߼P$߰X߱H' 1h$| ( %@(% % ߦ' 4%@ H 'ߩ@)\$!$DD}߿X %t0%$ $H߿߼P$߰X߱H'%$$ $| ( %@ % (%$ kߤ[߿(% 8C$-e&(%C(  % K߿߿߼P$߰X߱H'߿߼P$߰X߱H' %ߦ8'9%h& r$ߤ@'9@ߦ@% iЏ߿߼P%߰X߱H' %ߦ'( j8@o߿߼P$߰X߱H'X %t0%$ $߿߼P$߰X߱H'ߤ !'@ 8 | ( %4ߤߥ@% m@@(%  %$ kߤ߿tߩ&4'8'H$Ѝ)@ @!| ( %@ %$ 1'H}߿߼P$߰X߱H'߿߼P$߰X߱H'߿߼P$߰X߱H'߿߼P$߰X߱H'0%߰U4߰R8ߡ04!8M!߰J@| ( %@ %ߥ 1$߿' !( % )%@ %0 4'@߿08' 4 %@߿0D pߦߥ $Gl'@(%$Hl ̸$ '߱8߰ ߲('`߰ ߲('`'<'q?!lh'9` j$߿߼' '%  ߿ &1` % j %$ %߿߱߰'0'8<0'q @8!,( % H@%d@(%'  &4@% (G 5ߩ%$ #! ?ߥ'9@)@0% % iЬ߿8%߼0߰@'p $ ߨ(@ ߨCA _߼0 P߿8 I߰@@'p@H%tߤ@%ߦ '@$  ߿8$߼0߰@'p'(< $!o!!%$% 1h %@0%@% % j(%߷@%@ ߿#$c߰`#߼ ߱(%߾'P| ( %@ % 8(%t@(% % $߿  %߿'p8`P<h'nX?!%(%@(% % 81H,0@ % 90''  %@P%@8%`^H9` &$4@P%@:@H%(I (%( %%&% (@%߫(ߪH&) @%Q 8%$+'H %*$ 0" ߿`@C$ $ !  A$8`߼h(D!%C8"E8!8*@#5(߰X %߱P'( % ߥ0@@%`' rx߱8'9(% 0%ߤ@ t<'@ 4ߤH߿`߼h%߰X߱P'B _'_߿`߼h߰X߱P'"<" 0 $Ǯ%0$Aɮ! %(% '@%!($"$<'$!l!!%$B@ $c` 4 x %߿߼߰'0߼߰'0 4 ߤ߿4884"!'0<$!j!!h$% (%'PS  %T&'Xb   %@T % '`@mTtDd !&xTt % $@&$@%D' % %@St %% $X@M'8&(%t %% $@* %'x %@%t %% $X@' ` %'h% ߴ8@ t %% $@t %% $@ߵ@@ %$' <ߵ@߼'@ %$'ߵ@ <%`)@ %-@ %߼߰" ߱߿(߲ ߳0ߴ8'`8't % $(@Tt % $8@$TD'hd !T@ %(% <$P!`(%$ <%@ %(%$ <%߼D' % %@t8't % $H@T % 'p@"TD'x[d ! %% $X@t8l' %% $h8'd˜ @ % `(%t@ %$ <$PF!t % $X@TDtd !3&Xt % $h@TDtd !(&ht % $x@Dtd !&x$(% <@ %JSP!F8@@%$ 4@%ߵ<D 6 ߨH& DH%& %'!!4$ @%G!BT$@&$  颤0f!c0c`& H@%Dߵ@ߴ8ߥ(!F@ % (#Dd !%'<$!e!!% % %(%8%@% '߿ ߼߰߾'P  %@0%'pH@0< $!e'!!%@%8%8%`0%`(%(  % %`(%'@%8% ߦ8ߥ@ߤHߪ(Hߧ0߳+H# @!  8!߿߼ ߰'' 8<$Bd@$2'`%@%%%4%"!0!@x$,$ H̬V߭ߣ0߾17`%! `%߿~+%4$ `(p$ $ (+xߣ+P+8 %0%x#`ߨ%1,10%Ј!`+<0%0>h+(+!5X$''0%'9ߨ&< ;ߪ v5)$ $AߦX(+߬߭8ߡ  %--` $B!"Ј!$@%Cu`+$BX%`+$Xߪ(%ߧ@ߤp'00#ߨ 8#ߦXߤ߬߭$h$,H!@Џߧ'9''ߨ0% vߪߤߡ@0%0!ߨ`1߭H߬ߣߡ`* 4cah*s- ߡ߬߭xߣ(`!߭߬m!%%ak%߿߶pߵ(̌ (%0%$$   %MgŒC `! `Cl!C ̌ h*$BM$`&,0 $ Hg8#TC g!C ߢ 4$ C# ߣ0̬ ̮̭̎4a ߢx$߬ߴ(߭ߡ"' ߼߲߰߱߳ߵ߶߷߾'`  %߿̏ߤH !h  `ߦH@ %ߥ( 0߬('ߥߡhߣ`(xH߫pߨi (H!Ѝk +$'ȏ'0%'9P`*H#& vߪߣ@(+$AߦX$`߬@`* ߭P߭$P `%h$߭P8'!<!4c#$ 1+H%1&(+ < ``!5`$#x!p#X0%8%ߩX@%(%ߤp %)ߥ߭Xߣ#!`! ! &߬_ߴ߭ߣ!]aY ߤ(}ߥ ߤ0A$ <'$!\!!߼'  ߿'P08< @$!\H!!%%%(%@%L`% *P%< 5@: `hX&%'@%%8%0% (߮+ (%`* % *nX!PH#ߦ@!^P! lMP!!#&1# b*@ 2h%&s@*`֏%߱h߿X߲`߼@߰0߳Pߴ8ߵ(߶H߷ ߾'߼@߰0ߴ8ߵ(߶H߷ ߾''p(@0<H$BZ "!%' P8'''@(% p %@߿ ߦ8߭0ߪ@JHL4H @!߬ ߥ(ߤ8!lX!J  @!߿߼H'<'x%$!Z @%!!d% & H%P%`(%8  % !*h%@%@p%%%J %)%((#((!߱$߼߰'PD!C#' *8*@0%<$4B*8!`Ax G, "L!* 0%%@(*&1#n߼(*߼߰ !߱'P #$ "߼߰߱'PC#% %߼߰߱'P#%߼߰'P'$8# & $߼߿ $߰!߱'PC#$B(*'p< 0$!X!!%(%%%( &%X$ShX# X0%@8  % H$&R%G#@@B$%q!@$!H*`$`M߲@j4SP# ߳8 ߳8BA$߲@ ߳884j!#%* ߼0 %ߵ"A!C*A#C ߰$߱ ߴ('@80%% ߲@߳8߼0߰߱ ߴ(ߵ'f#q!ja&sAP!E@%H$`%PX'8% (!ߤߧHߩP߿XH@%P0%X'E 8%Gߤ߿X8!ߧHߩP߼0߰߱ %ߴ(ߵ''H@P<0$!U@($% %%8%$ 6!!W8V4*@0 ;DhPD`Fka Fc!F DR8*@@%5!>&1 @!i8*(#0!f#3#$Bf8* *&0#`$@0#&߼8߰0߱ @%߲P߳Hߴ@ߵ(߿߶߷߾'߼8߰0߱ ߲P߳Hߴ@ߵ(߿߶%߷߾''% P%$$ !5$p!Y/$L+ccx%%Jh8a g%k4 *ߣ8!h! @#* *ߩ h*`**ߤ%H*  * $ ` I %$%k'@%'@%'@'@' $(<$BRp% $)'"!% x%߱$\%8*?&1ߢߡB $!"* Hߧ# g$ ! &$$ 2%8* &&*`'g8*&0!&s(( ''' ' % %&*' % 0%'' % 0%'"BC8*&$t߱߷߶߲߳'0%%$   %߼߰߿ߴߵ߾'%$) '`0X`%( % !(% 8|@% ( %t@ %@%t0%$ 2$߿ $߱Xߴ`' P80H' @s%|&( & &(% 8%, @ %ߡ("&!+`\(% 8%@%T'$8%0% % ؎@Y$ @@ %I$ J$ $A)$C7Iޏ %@(% '@ߡ(լ* %@(% '@Hߩ(˭#@ %(% 8%@8%| %`(% ˔$($ ߪ(ICB@ %(% 8%@8% %`(% ˔ߦ$ߣ(A@b  %@(% '@Eߪ(I߰H߱X߲߳ߴ`ߵP߿ ߶8%߷0߾@'߰H߱X߲߳ߴ`ߵP߿ ߶8$߷0߾@'߰H߱X߲߳ߴ`ߵP߿ ߶8$߷0߾@'߰H߱X߲߳ߴ`ߵP߿ ߶8$߷0߾@'߰H߱X߲߳ߴ`ߵP߿ ߶8$߷0߾@'߰H߱X߲߳ߴ`ߵP߿ ߶8$߷0߾@'߰H߱X߲߳ߴ`ߵP߿ ߶8$߷0߾@''P8%$ H@%%%I*$x$@#hb#@!` ab!@|#°!$!(!!$@!8#a!8!p8"#X8!!$7!P$0$##!(!!|!q 7` % ` % (%@ % (%$ 1@%ߧP&ߨ0%'ߡ(%UYߣ=ߧ` % (%@ % @(%ߧPՎ߱X߷`߰h߿p߾x߲߶߳Hߴ@ߵ8' (% $ 1h@0% % ߥ   % 1h$@% t@ %@%` % (%@(% %  0%ߧPT'$|' (% %p$( $@߿p߳Hߴ@ߵ8'| ˄$(@%ߤ ˄ @%L$I' % %%(% 8%D$-@%6$*H''ߥ  %@ ߿߳ߴ$߷߾'`(%% 8, @ %( $ $xpHD*P@ j|&R($&J@X@%&I0`&CLhA&l$- $D@ Ic Hi!$ c O5)i$`%@o' d'` % ut@'ca߿~ ߾w߷s߳ߴ' %(%`8%ߦh ˔%V78 &)H* (% !% 8@8%@% %(%@0% ˔%&1Vᯢ8뮂߰@߱P߲x߳ߴߵH߿߶p%߷߾'Џ %'8 @4߿߳ߴ$߷߾' %(%`8%ߦ` ˔%@>8Ů %'ߥ '@>߳߿ߴ$߷߾'| ( %@ %@%t`0%'@ 2$p߳߿ߴ$߷߾'8Ai$ %'' @߳߿ߴ$߷߾'%/ %(%`8%ߦX ˔%@8ߥ'9 %@% r߳߿ߴ߷߾'| ( %@ %@%t'`0% 2$߰@߱P߲x߳ߴߵH߿߶p$߷߾''h<0$!D0!!$@%(%( %'` &'@$-R& 4 $ (%X <'@@C%$Q`(@%@HP8''D &8D&1&a#!!0!  %0DD&0+&ꮱH@8P߷8߳@*߱hx]&߲`ߵP% vߴX@, `%, v%@ `% v%@ |(% %%&s( ˔&fP|&s( v%@ %(%&f ˔%$  v%@ %(%&f ˔%  v%@O$[f' % l%@>߼0߰(߳@ߵP߿ ߶H$߷8߾'߷8߳@ߵP&߲`߱h v%@sx %@'JIHG F$E(D,C0A4JIH G$F(E,D0C4A8&߶H'@ 8ߴX߿ ߼0$߰(߾'$ ` v%@$[> %' l%@ ߷8߼0߰(߳@߿ ߵP$߶H߾'߷8#% v0@ %(%&f؏0 ˔%$4߳@% vߵP@4 %('@ 8߶H߿ ߼0%߰(߾'$ %'x$% ߷8ѯ $?$*AC$%%'p (%%@%N#M!$BPP߰ 2#CCR FQ߱( ߲'$! 0B0!(8(# %@( $ߦ0߿@ߩ߬߫iߩ8@h%ՌN <'$!>!!% $ @%@%@H%8%$$!(!c$  $DȮ"@ %  ߼߿߰%߱'0'p8 <$!=P(!!H@%$P %@ %@%(%0 $Pߩ8ߪ0(% %@8%Q% @I $L@(%P'( |دT@X߿(߼ $߲߱'`  $ wߣ,c`$ wt$ߦ $!@z߿(߬$ ߰ߡ*@+D!@ ߤ$`0%&14@(% % 88#߿('h$ @0%@O߿(߬$ C߰Џ@ %t@%'p& $(߿(߼ $߲߱'`$' ߦ@:߿(߬$ ߰Џt@ %t@%$ H& $(߿(߼ $߲߱'`$' ߦ@ ߿($<(%$ '( ߰Џ H%' '9`ߨ$@(%'( |د,@@߿(߼ $߲߱'`$'x ߦ$ c@E߿(ߡ$#߰Џt@ %t@%$`& $(߿(߼ $߲߱'`$' ߦ$ r@^߿($<(%$ '( ߰Џ H%ߨ' '9`$@(%`'( |د,@+߿(߼ $߲߱'`$<(%'($  H%ߨ' '9`$@(%`'( |د,@߿(߼ $߲߱'`, ߬ l*`ߢ0BMh*^ߪ4JC*`Y8N`*V<Mh*S(0! ~| %8'`t$ߦ $p$ c@߿(߬$ 8߰ߡ$#F@ %ߦ'9$&'ߥ ~$߿(߼ ߲߱'` $`` h`@0% @^`P |t@ %t@%$" $"߿(߼ $߲߱'`t@ %t8%$"H $ ߿(߼ $߲߱'`'% l@ %@߿(߼ $߲߱'`tt@ %H%t%"0$"& $(߿(߼ $߲߱'`8߬Eע0ׄh(F"!2E߫8 k 5 L & % %1   %ߴ0%(%P% TH% ߱`$$ ߿x߰p%߷X߾P'4ߡH%ׁ` %'9('('$' 8@b߿x߰p߱`$߷X߾P'  %@t8%$ %$ $h߰p߿x߱`$߷X߾P'8% %'0  $@%@%@߿x߰p߱`$߷X߾P'| %'菆t(%$ $!@߿x߰p߱`$߷X߾P' 0e߿x %g4 %h8 %(%'9%'('$8' |0@'D % (%߰p߿x߱`$߷X߾P' %($ %($84  9 %H%@% 8%@-߿x߰p߱`$߷X߾P''9 ( % $$80(  9  %(%P%H% @%D@% % (%߿x ' ߰p߱`$߷X߾P' 4!  04c '(% % '9@@  %@߿@0" 0 $$(@@A#I"@F$2E,8@\@'9@ P %$!0!8߿@ Z$8 $ ,t $ $ $ H% <@%$  0%`*$ 8 8ߴ8@>߿@( ߴ84`  ,)*0!#'9@  %߿@! 0! $@H%i߲0$H@' ߲0߱( ߿@'960 % ߿@߰ ߱('`A '90@ %$! ̮A H$$@ %$ E#&+ A߿@'<L$!%%!!" b )*߼$%߲߰߱'  $hRԎ$D@%%@% 8 E80,4($$YL TL(8 $ ,'('$ $@ %$0%8%$ $$ @%@h%& <%%kM!L!!$B`a$zw$ j$h$ȏ ߨߧt'0'ߩߦ%J$ I( , '0 ' (%D ʬ%' (%D ʬ%ߤ@% )" Bi!C!B4H ߴ)" Bi!ߴC!B8'@ %<L  4 '9 % d  ;' DH ߿'960 % ߿߼%߲߰߱' (A 4$ $ $ ȏ'9$ Dߤ'9T( Dߤ'9T DT~ߤJ@%I8%0%(% TD $#k(J@eȏ|"#$c#!)$# !W(% $$$'90 '9@ P %߿tt $$`?ߨ'P(0X8<P$B`%(@%%H%%  "!߼H߰8߱0߲X߳Pߴ@'d0` % Ht0# %d 8#߫ߪ(d(4ߨ %@H% ߦ  @%8 %0% d %0%8%d@ @%߼H߰8߱0߿`߲X߳Pߴ@'<'$!(%$B"! ߼' $ $B  ̸$$߿߼' '0(L<$!%  !!t &R$@ % (% `% % 0@%L ߿! 􏄀t% $$@ %ߴ ߳(߲0߱ D߿< ߿H 8%|0%(% $  %߰߿߼'P<'$! !! %ߤ@(% L߿߼'0'`0(@%*8+ H' g!*`@!@*p  @(%@0%  '<Hߥ  0% ߤ ' Hw<HL & % %1   %߰0߿8߱H߷(߾@'( # <b] 8(%0ߤ 0#*P!^@*s < >WZ 64ChPp%%X`#!Hð!A#ߡ#6#I!!!@(%%&s %!0 0#@@#t! <߱Hߵpߴh߲`߶X߳P  %ߧ<` HD@ߤ(% ߦ </D"* s@HnD( ߦ #(!8 !0 0#̎ <W8#0ߨ(% #8 !0 0#~ <@HDC@@@*?H' 0'8% $H,+,e߿ 0,(`+ D$$)D H8 -H!)j IHj0 (! l(߿ (d4 @0% H( |ߢ(߿ (,,+e0,4`hl(  #4+d߿ , a^ i8(%0ߤ 0#߿ ,*P!L@*j 4 @ߨ,+eN 4@2c`H%XP#!@ð!A#ߡ@%v#A!i!@ %`(%%&0 0#,!@g#@#s!! 4ߵ`߶X߲PߴH߳@  %߿ ߨ4+ ,10߰8߱0'( 8(%0ߤ 0#߿ (f ߦ #(!8 !0 0#Վ 4( 8#0(%ߨ #8 !0 0#߿ 'd$ ( %'  %$/(C(F@8%߿  @ %%@%%߰('P`d$ߢBL$$$Ac$Ca$F/G-@A߿ $߰('P$ '%0  %$/(G(A߿  @@%#f%% '0%߰('PߦH$d*`߿ %߰('P %ߡ08ߦH$b*`߿ %߰('Pd$ '%0  %@8% ߤ! ߰0(C`(F߿ (%߿ %߰('Pߤ'9 DPߧ$F00*߿ ߤ'9 DT$A0* ߿ ߤ'9 DX$Aߢ"* ߿ %߰('P%$$ $$B'$0(% % '$B& YY0@ %'8 '@%(@0%`߿ @+Q @ $X@%@%@ %(% $DEסA 8 G@$@ @$ %@&H(&<߿ $B!!!$@aߣ(@ Pr ' 2$' &R2$"0F߲8 ߰0 (%߰0 $!"߿ $C$"&$0G߱@'`菄$ 3$&$$B&'9  %߿ $!' ' 0B@' ߥ ̸$!߿4߿' 8( 0@x't'' $$ߩ@6F Xxph`טpהh4(HHF ߡH (`3ߥ@8$M$K&8ߥHŠ % #  ߡH !&D%%߱ F!U"&s"P!"!F42E&1 D`Fc!F F% F#F!.!!D`Fc!F F% F,F8BF kMDh#$BD`Fc!F F% F,F8BF kMDh%D`$DhFc!FkaF-c% F FF8F D(&sbH*&1  P!F42E$H)%H)$cC`!$Cb#$c`H*@$a@#i %*%H8 &H#8%) @*%&(0 0ɯ߰߱p߲X߳ߴߵh߶߷x߾`״8׶(׸ ׺0ߩ@߿(׼'5(ߡ@%8$ "4B6"$3ߩ@4H0(*0 * $ $A$H'Ќ P<$! %%!!$ @% Ў 7Ԏ P %$&, (%@@% 4` % % ߳߿߼߰'0tt $$'(%% '% 4$&@o08!' 4 %@߳8S h'c#'f 'g$'aaF!2E'!*ߴ%`߿ ߰߱0߲('P􏄀' 4$&@3@18f P @%e$d P%`$ E#` P' 4 %@߳8@߳8S dea  g$ffۏcF#2Eԏ߰߿ ߱0$߲(ߴ'P'Ќ(<$!@%!!H |߿d  (߿8 ߿4 ߿$'90 ߿L (% L (%  Ў 7Ԏ  %߿߼߰'0'p (0 @8%%a% H#9 % h@0% % @ + $@%t' 0%ߤ $%߰0߿H߱($߲8߳@' `܏\(%ߤ $0%ߤ`(%ߧ 0% ߨ@ߡ!$  5ߢB@5ߣ"\ @@%t'`0%ߤ $%H߿H߰0߱($߲8߳@'t@%t 0%$%0ߤ $"߿HH\ߨߤ(%0% $߰0߿H߱(%߲8߳@'ߡʬ+$ʬb'@ 0 (8%1%@"* % h@0% % @ + $@%t' 0%ߤ $%p߿@߰0$߱(߲8' ߤߦ (% ߧ@%߿@ @ t0%ߤ $%߿@߰0$߱(߲8't@%t 0%$%0ߤ $%߿@߱(ߪ߲8P߰0'<'$!p!! '߼d߿%'0߿߼'0'P 80<$B( %%%%%% "!P!*P*5X#j ! SX!+X*2`# `! !'$(*S@!*h(%'9  %0% 0 !߿h#DC*@r*@P*@h2D5@h#"#x" p4B" 2x$ pX uX!>< # %K#j!XPH`@`%P* "!m#%%p%@x%! (% %X* % 0%+ p#8#@/!$'%!Be!B"$E(!X%P%@h%m`!l*P!JjP* X#Ox! &sq!t`!ߥXߨ@ߧPߦHH' 0%ߤXߥ@ߦPߨH߷`'94߾p8% 8ߴxߨHߦPߥ@ߤX茊8% T߼߰ ߲߱8߿h߳(ߵ߶0'% tnx`WKhJ (%߼߰ ߲߱8߳(ߵ߶0'$n$ *l vX*`h `*dc`6^ D[ %8(!0 0#XPH@`X!k%P!J'($<8$!%0%% @%%P!! %pBI`H%`d b"@ߣp`!Wh#L`* p"@Th!Mh*R#- ߡp _]߫p"X!/Kp*T!QP*0% % 0 8<@(%'9 n( & .%ߵ߿ ߩPߵ#<"$DD`* -@h*2D7@ư##! 4!!  P h!%` `!%iHR w!-<`!h##h!x`X@`%hh# 8%߭ߡߣ`! VߣߨH%h@*ߴhh  @%a# 8%߫ߣ%߬$) ߡkX!-@ 4!- `%߷p%`* %@%@# (%* hY!h#!(%40!`%*! #*P#ƈ!_!` %$A@%C$h%`%.L*ߥxߩ@ߨ`ߧpߦXH' 0%ߤxߥ@ߦ`ߧpߨXߵ'94߾ 8߶ߨXߧpߦ`ߥ@ߤx茊 T߼ ߲߰߱8߿߳0ߴ(߷'$!'߬hh`!bh %ߣh`!ZhSe#$c#~3/D%d#`#$cl)h,HߩP"p %(%0%@8%ߨp |H%߼ ߲߰߱8߿߳0ߴ(߷'! ߼ ߲߰߱8߳0ߴ(߷'@߼ ߲߰߱8߳0ߴ(߷'߾pH,Cc' %%%%:% 8(L@80&60@ %`(%0%8% @% %R @@ %ߴ8߿0D*(!߲( *߰@S*@߰`u!`@3H* ߰"*@@$D@߰߱߳ ߵ߶'p߰߱߳ ߵ߶'p5D@' x`Ȍ$8$$A+X$ I)x$ ߡ`4#!a`߳*` ߣs8 l*a` `h߰߳߶'h~,ߦ`($$(($ߧh`fpe(  gi$%H&-)b l%`߬##ߩx߬ 4i#H<`!`!߬)!#!ߡxx$,$#ߣ߬`pH##X,!$!$)9$ >H*#ߢh߫ߪx߯`߸hߧ߬ߦG߮(d H%@%h`8%p!`! ߡhߩ߬!H#`! ߣh߬H* b`h߱ߣߩ%(@% @8߳ߡpߣ ߬(ߩ߲@,`!(߬h#! &R3!&1L߳8ߵ(ߴ ߣ0!%HP `H%߬`@߲x8߳߹8 %9Lߥ ߦ@ߡߣ`$!&s&R#ߩX%@%&x%߮X [' p!ߩ& #h#@J$# %@X!iH* l! b!``#!$I Ii!$c*``*  H!%0H!%%) T%'i#֡& $(  H0!80H!!P8!)PP1!H!$8! P$ 8'8! $ ߬P%P%$ ߣHg$cH($&ӯ ߤߩߵ( mߢ ߬`ߩX@ !8ZIH!ߴx0;& 1)% S9H i.H# H.H##!h!h!% iBh!%*`*h h H!) T$ 8H#I8!$ 9P0ߣPyL@0%ߥ ` %ߤߢ߬&ߡ`$ߣ0%&$B$c0$p*8%I 88#ߩ0 h%h!)* i! mh!``#h!g$cPh!%ߡH'$!Hߣ߮``߭(ߧ5ߣP $$Oy0!` J`# ``# i!L!C!$BBO!$BH@x%pB*ߣ@*  #p $I N<'Q N?&(A& ` 'Qa a ߣ~<~?%*ߣP!$*x%xx# %߬Xߢ#BO!`!* H,H!`"!ߣ#c##"!!$B$c߮xP%@ߩP888`%bߵp߱x߷ߴ߲@ % ߾h߰߿``߳߶'A%x't''` $$))$  ߿`M)ɏ(! ߡ`X$ @D'H<$!p% !! %p   (%8< %0H 0#L4 4  (%8 %0 0# 0%(%ߵP%߱ TH%߿ ߼߰'@'<$BP`P%e*%P "!H%*jH   %0% *'9 `(%?0 j* C( @% 8%0%(% T߿߼߰'@'@%<$!؀%!!(%@%'9  % 0% @% 8%0%(% T߿߼߰'@<$$$$## <'$!א!! @߿%߼'0'9P %ߥ@0% 4ߧ߿߼'0'X%%%<$B #%"!׃'A0 H#D׀FF F#*# Hc*H! Ii!i cDDF!FaF"F!ׁF!F DtT(%$% %@t(%% $%@/t' t'0%` $&'$''$ %dxl 3@%ߪx@N8<h4B%@@H%P R@%ߩPߣ@i*<``56s(%% $%@'((% %@'8'0(% %@'@(% %@t&%t'H'$& %'$''$ % @%dl`P%x %$̏lt 'H@ `' $@`t`% $&0d$@%ߣpCP# H*H#r# H*H!Q HAP#C* P%H!E(!#(  bP#H#&# 0*C#& 0@H*I 0#Q0BP# P@$0!EP!$0!,"H&$(I0 $"& $e* (b( ,ߩ@ߡhP*j hH @&&sc*`d%' ut@ 'P %0# p (%$ P+ *( $$ U߶Џ0$ i&$@#( ߪPߣ8*a 8P P((!' ' $@y`ߩ@3H* p %߰h!H%$-& %$&sa@%$-& %$&sc@%$-& %&s$ i@%$-& %$ &sj@%$-& %@%%%$-$D %&s$a'$-$D %$&sc $-$D %$ &si$-$D %$ &sj$-$D %$&sa $-$D %$&sc$-$D %t'@8%<ߦH@@%6s $&`$-' $``%@ߣ``}ߥ8 % %ߤXߦ`'9P (%߷' 4ߴ߼߲߰߱߳ߵ_,߿ȏ^0߾'<'$! H!!@% D  %߿߼߾'0<'@h$!X!!P%`(%% 3''8$'' 8p1%x߱pl $-0'<(% '8*`߾x(&1&$-% %@8$-%$^  %@쏤8@ %1%߷߱ߴ߶߲߳ ߤp'@ 4'@ $ % 4%'@ 4@%@($EE߲߱ 4L'߿`߼h߰XߵP'&a#!!0!  %'%p%`%<<4c$BN"!99x!h%<9(4B "$/9 p  % P!JLߣ8%Mh!m*<߫`4B$8% %xX!kbX$`$p%%1$%`ߪP*J0 j` 8 1 ` 1&% %p `#8'@p%%% '@'0 H`(<8h%@$BP%"!P0%%@% ZߡPx߾Hp %$1X&O!h'&1>/&!L#ߤ @8%ߥ@%`P%ߦ%߫ H%h(%DH 0%$S! %'9Y0' Lߤ @H%ߥ@8%ߦ'`P%߫ %2!!L3!߭Hߵh߱߰߾x߶pߤ @8%ߩPߥ@%`P%ߦ%H!߫ 4H#߼@߲8߿X߳0ߴ(߷`'ЏX&O'p@0( %%%8`%%`@%@%D%@8% %H% P%,h ߿h(%H 0%@H%H8%0%L@(%` % P @!h߿ 04$ (%0% 8%xh!H -#@H%H` %@(% P0%8%ߴ @% ߶߿߰@߱0߲߳ ߴߵ(߶߷8''p@%xh%% %@H% Dp $Tpߣ'$ % b@ ܴ %`@% rx'd' ut %@ߴȏ`'Џd rx@% %' ut`%@ ߳ߤ@% rx$, % ߲߲߬'CA L$ C(A,M0߲ߤ '"p%`# l!D׃FF#,! !l!#!#! DDF!FaF"F!ׁF!F ߭D ߹H64L48Ȇ<$>@2<07H','+0DH%'%%&' +@@%!!x!?*x*+x++x+h*P%*0%0p L p%%&!*++$+!D*h*9*+$x+# **%% IL# ', LN!&* ++$+!X**,*+$x+#** %h% )Lh %LN!'H#h%%%$ $d*߹%*'8 h%'8^L+L X+% X+ˀ 8D8#'<`+8 `+!lP%l`* h , <+ + ' (+&(++$``%h$0L-`  p%'<@'3P%e*(%aL+%`+ % -D%$ +h!8+@%%8* %' B<'9!@%P ' `%@% 8% 0L ++++P&C`$h+b*$_*8 @&oL+%+ % #D%$ +g !+@%%* %# B<'9!@%P # `%@% % 0L ++++P&C$+b*$* @%aL߭++h D(% +ߤ$ +h!"`%"* h <%C h h ++ + &+߬+$$߸ x%|P` @%J`%D%$@8%$߰%T*``*@$%؏'8$&Y0'8 L%@T8!ߩIH!(L߭ ``!$L@!(L&1&3&R L %Lp߰'$3  %pߵߴ߶߲@%߳ЏߣaL'ߨ$4 %% P@߿߬P߷pߥLLh!h*߱x߰h߭`#Pߢ߾'ߤ쌄P L g`!߭ `C٭Lߡ$p$ `߬$P߬$ۭPߡ>P$-L$x,|$\1 0|%`!c` $%`$!!0!0h!c$'@ 8(0h$P(c$H`%<%$@@$!$X@% %00p%, $"+ &1 R`$5 p,"0A  #`$ %"$  %" $ %ݮ"߱ ߴ߿߲$3x߲x߷ &a߱(&_ $` %(%&8%ߨp %@9@%*C`D&R` %ߥ0@0%'@%ߩ8 h%@Q&15k@箋߱ ߷ߴ߿߲ߵ&a2  $ p$%R߼h߰P߱ ߲߳`ߵ@߿߶X%߷߾H'߼h߰P߱ ߲߳`ߴߵ@߿߶X$߷߾H't` %t@%$&& $&x߼h߰P߱ ߲߳`ߴߵ@߿߶X$߷߾H't' $&` % '߼h߰P߱ ߲߳`ߴߵ@߿߶X$߷߾H'@`$+ p&1 $0$ $! #k%`$ߡp`$$$ 7@%%ߤ0 \& @.` %"@#0c`` % 0%ߥ0@8%$ߩ8 h%P@Ў+ ttߨ0'0'$', $&` % '0߼h߰P߱ ߲߳`ߵ@߿߶X$߷߾H'% 0%ߥ0@8%$ߩ8 h%P@+ ttߨ0'h'$&, $&` % 'h߼h߰P߱ ߲߳`ߵ@߿߶X$߷߾H''pHXP(0 %%% %@$@%%82%$@; r& 0 (%`0% %@WP$WߡA$ %+ߴ8ߵ@$߿%e߳X%D5ߣJ* D$7$`$$B ߰(߱ ߲H߶P߷0߾'3H!) ,,%ߤߵ@ߴ8߶P@%t'` 0%߳X߲H $'0߰(߿߱ %߷0߾'@%t'` 0%ߤ $'H߰(߱ ߲H߿߶P%߷0߾'%@%t'` 0%ߤ $'߰(߱ ߲H߳Xߴ8ߵ@߿߶P%߷0߾''P8PX$ @%%H% %0 !% (%t,2!$c'p@C!Jߡ0%@ߣ0td $'߰P߲߱8߿߳X$ߴ@ߵH' 1Jj ` %(%  0%@߰P߲߱8߿߳X$ߴ@ߵH'j%$" $$`& ߰P߲߱8߿߳X%ߴ@ߵH'` %(% l 0%@߰P߲߱8߿߳X$ߴ@ߵH'` %(%  0%@߰P߲߱8߿߳X$ߴ@ߵH'%ʮ %$ˏî"3($ k$ߣ(#ߡ0 %ߤ Dߪ *%$"߫0`&(%` %  0%@߰P߲߱8߿߳X$ߴ@ߵH'%%"$ #ߤ Wt@(% $ߪ0@ (%$` %  0%@|߰P߲߱8߿߳X$ߴ@ߵH'߫0`(% ` %  0%@i߰P߲߱8߿߳X$ߴ@ߵH' (%` %  0%@W߰P߲߱8߿߳X$ߴ@ߵH'`Ꮩ,` %  0%@E߰P߲߱8߿߳X$ߴ@ߵH'4` %0%ߥ  8%@3߰P߲߱8߿߳X$ߴ@ߵH'0` %0%ߥ ( 8%@!߰P߲߱8߿߳X$ߴ@ߵH'"@@%8%ߦ`(% @ ߰P߲߱8߿߳X$ߴ@ߵH' ߢ `3ߢ` hKߢhߤp Č_ߢpߪ0@,"߫0`0%` % ʬߥ@߰P߲߱8߿߳X$ߴ@ߵH' 0%` % Πߥ@ ߰P߲߱8߿߳X$ߴ@ߵH'ߣ0`x0%` % pߥ@߰P߲߱8߿߳X$ߴ@ߵH'ߪ0@j0%` % lߥ@߰P߲߱8߿߳X$ߴ@ߵH'  % $D@ %@X% (%ߢ` %ߥ j0%@(߰P߲߱8߿߳X$ߴ@ߵH',  %@(%,  %@(%,  %@(%,  %@(%  %@(%` %(% X$ߦ@M߰P߲߱8߿߳X$ߴ@ߵH'  %j,  %j@0%,  %w@0%,  %@0%,  %@0%'`(8@% <%0$c 0%!#!(% %tH%$(!'X$ A <P$T-%`X$3$$@ t & Q$3$U$2%`$ @󏙀ߤ'9kߥ0% ߧ@%ߤ@0%'hߥ @%  %'p߳`߲X߼0߰(߱8߿HߴP%ߵ ߶@'(%0%'9_ @%$ߤ '8$߰(߱8@@%ߵ ߿H$߼0߶@'ߤ'9kߥ0% ߧ߼0߰(߿߱8$߿Hߵ ߶@'%'௠ $"8'9m' D' @% 'x 'x`hh' נ$@%$  ߿) " @ @%߿%߰'  ߿h' נ$߿' p%t%`%'x'$c'/!h!Ȁ #!! t$B(H'P''C ߤ 'ߢ߿ߦ (խߢ߿߫b ! ߏ |߿׏  kt߿Ϗ ܍߿Ǐ H߿ d߿ ߐ߿( 䍤߿ x߿  p߿ ߿ߤ 'ߢ߿ߦ (խߢ߿,ߤ @%8%0%(% z߿<'$cp#!$"8$$(%'9_ 0%$(! A@ @߿ $߼'`ߨߥ'9m@0%ߧ %%  D߿߿ ߼'`%'<$B%$ %%3I"!0(8@$ %D k%@ s5& @$t$T!, %(`  !Eꏙ %@E㏙ %߮@E܏ D %خ@EՏ %Ѯ@EΏ  %ʮ@߰@߿(߲0߶8߼ ߱߳ߴߵ'p<'0$B@"!%x [%$&H08'c8!'9g! @@%@߿(%ߤx ʬ 0%@ 4ߤ߿߼%߰߱' Ȁ?!!X O߫NߪJ0@,@(@$@ @@K$ LM B I@%'$) %   "$߿߼߰ %߱'ЌQ !$!!'9` '@@(<0$BP @%%X%%H%kh!8`%-*` %% "!!Ch!-* $ p!hC$ p P%H%@%@8%`0%(%h % < %(%`0%X% P%H%@%W8! <8#$ P%H%@%@8%`0%$  (%$   % %(%`0%@8%X%P% H%@! @#߼`߰H߱P߲ ߳(ߴ@ߵX߿h߶0߷8߾p'0BH%$',P%<$B% "! % ɼ@(%ߩ$߿$$t"(߼߰'@t $(߿%߼߰'@"$߼߰'@",߼߰'@'<c$!$Bଁ"! ߼'0 (ߤߤ ߤߤ ߤ ߥ  Dߤߥ$  (ߤߥߥ(  (ߤߥ,  (ߤߤ 40 ߤ߿߼<'$Ƣ&! W߿߼' '<($!p!!0 % %$f@8%2$g:$r0G$spt %' ߦ@R$st %' ߦ@ t$ߡ(߿ ߼(%߰߱0'`ttߤ 0%$(، $(߿ ߼($߰߱0'`' % @0%@$gߡ$߬( %' ߦ@$rߣ,c`$rߨ$Э %' ߦ@$r0$s %' ߦ@$sߧ$ߡ$ (ߣ,c`$rߨ$$<$$cp#!$$$ "t$$B)$"$"$"$"$"$"'hX@h%,%<p$c%` #!$$ 80! $Lk&$ vX!c0 '%$(L$# $!$%$T$S$&'ޅp,!@%3&54% K%l&1A#$'9@ %(%ߦ $'L8#8!FF#C!F* 8!G% B'(' ''ߨ \%@8 _X?#!0O'(' '0@ %Mߨ%p#h# \2@ %'8'''0 \%'9@ %'@ߦ $'0E0@e#d!H2B'H'@B%#(%!Jߨ \@ %ߢ *&``##)X*,*߬9kc `&3ߦh,L$ ߤ`$'ߥX P% ߢ*"(@ :8e%ߵ߱߾߿ߴ߳߼߲߰߶߷'`ߡ  맫ߦh͌(Pߤh ɼߥp߿߭ ߢPPߤpߪߥX8&$ߦh, O*H!$ P @@%x HC 8%ߨPߦhߥX8%ߩP%$ ߫xߤp H# P ߿߼ߵ߶'`'PH9`%,c <Ph!$B0@*"!@% `* P%`X% ௮߿`߼P߰H߱@'X$ (8H-P#0`-H#@! 8!߮Xߨ8ߩ0ߧ(ߤ ߥߦ߿`'p0($ <@$!@!!L8@%P% H%$ ߿ߤߥ ߦ(ߧ0ߨߩ P%߿߼@߰8'菄'$$ 3$&H߿''%'&1&H%!8$%%%׆ %$%%%%%%'DD%%FaD8%`%F!P%'F&BF9%@%F&'DF&9%D8%D Fa%DF!F& %DF aF&%D(FF&B0D F!F&(DF(aF& F %F&BF!$bF&D'@F&$m@$kDG8$iD Fa$gDF!F& $eDF aF&$dD(FF&B@0D F!F&A(DF(aF&B F $nF&B@F!%F&AD$X@F&By%H$$$ %a!ij$d(hԁԂԀ$eԋ$!$ g *)('Ԇ$ ԅԄ$! ԃ"! +g$b hj$! i$#%&K$D @B$! eA+8 0!(" '(L$$$)* (%#ׄF# ׈&$ %%F @F$!%F F(F DC8"$BF!F" D$!F F FF(!F )MF ! @@%D ( 8D < ah"#$ 8*(  @# ##' * $D*8 `I"@@@!8$c@@@# j!d1!!82&@# f!%%9#i#aN#(#`Xex"'$ߩFl#+.8#(# P% *E#(aP E! O8#*H!A8 ߮ HC-߭'p!߮h @߭L+(#*C#P%C!P 8#A8 O*H! HC'!J@%'P'P'(#@#ե'#J@#'<'?!'9P $߿߼'0'<'p?!'9P $߿߼'0'<'0?!'9P @%߿߼'0'<'?!'9P $߿߼'0'8(0%(%  %@ %@(%8% R&@%߿8@$߰0߱(߲@'ߥ |$((!@ % X ƴ@ %@%ߤ@0%0 X @0%ߥE@8%I %%$Ƌ 𨌥,߲DH߯ @0@,@(@$@ @$N@OPB @@@@@@$ K$ L@@@@@@@|@x@t@p@l@h@d@`@\@X@T@P@L@HKD@@@<@8M4J@خ@Ю@Ԯ@̮@<"@4@8%@$ƛ ܮJߦ %ߨ'9@(%&' $D߲@@߿8 S߲@߿8$߰0߱('t %t@%$0& $0߿8$߰0߱('߱(,% ߰0''8%<0($c (%% 3#!@@ @ %$ $c4I$dk$ f $i$s$tďI߰@&ߤ|t 8%8!$2 D p@ %߿8߼(߱ $߲0'pt&D $0߿8߼($߱ ߲0'p$' ߦ@$cߨ-ߪ$A߰@ttߤ@%$1& $0ҏDt$ߦ $1@$dߨ-$dI|%J H*H!ߪ$߰@A)ߪ$A鏙@(%ߦ'95(&'ߤ $kt$ߦ $1 @$ fI)(ߪ)J@߰@$!8C0c`U8ߤ$' |E,HM$' ߦ@t$iJ@pߡ(! ߰@@cH4h;%HDm$$'  ߦ@`$sH\ߪ)J@}߰@@!C4#% @ %!$'( ߦ@L$tC(c`Gߨ)T߰@tߤ& $1MD$ߦ'0 ߰@@ ߨ7ID p@ %ߢ߿8߼(߱ ߲0'p-*I$ *'ߡ(! ktC0c`oE8ߤ$ |F,HG8ĎD (% @ % @(%D D :$$2$&1D$ˏHC4a& A4AG<8ߤF$ |E,Htߤ& $1`񏙏Dtߤ& $1菙Dtߤ& $10ߏDߤ(I| %J HE*H!@8% )ߤ( @8% xEߤ& $1D8ߤ$ |F,Htߤ@% @8% xEkߤF$ |E,Jc' %h$a@% ܘ$߿( ߿0 %߿h  (߿l  (߿p D߿t  (߿x  (߿h$a@% ܘ$矠@ oP|%8 8!(% H % Ӹ$߿߰' ' %%%%@ %h$a@(% %@%( ܘ$h߿(h $a %@%@%( ܘ$矠( %`P%H%@@% 8% p߳@߿(߷߲$߰߱ '`D 4Klď YT@Ď8 ԎH4B@&߿(@cftkftH ` ` )#8$$ % x%@%$"$@؎$ k'8$ % |@%@߿(߰߱ ߲$߳߷'`$$@%$碀 `%@%@ ߿(߰߱ ߲$߳߷'`%( %߿(,(@%`% $@%@ ߿(߰߱ ߲$߳߷'`%0 %߿( ( `(0,4@$$ %@(% x$@%@%@ % @ % $D@ % `(%` %$a@% X$߿(  4 (`A4|& % @%@t % $2x߰߱ ߿(߲$߳߷'`D@ % @~8`$a %@% X$矠p߿( %& @%@#t % $2߰߱ ߿(߲$߳߷'`,H-.& %| l@%@ %& l@%@ߏ ` %߰߱ ߿(߲%߳߷'`Ď< ԎH@B߿(ȏ %t@%$28 $2`߱ ߲k߳߿(߷$ ߰'` %t@%$28 $2 ߱ ߲߳߿(߷$ 4߰'` 0 $DȎ@ % 0ݎ 5k ؏8 %$ |@M߿(߰߱ ߲$߳߷'`<'`p$!x!!(h`% kX<\B % L8FD< 4@ '  h@%  (``=h (߱x( kX< L8D d$$`$@  pK$ p$ 0'  t@%  (t߱xx) | %0߿h0! %߼p߰`'( kX<`B L$w$@%߼߰'P$%߼߰'P$ ߼߰'P%   %@0% % 'ߤ @߿߼ߤ%߰'P$$%߼߰'P $w߼߰'P$%%߼߰'P$%߼߰'P<$Bd "!9t, 8'94@8!`$""t$B40$"$"$"$"$"$"$"$"'(<$!c!!0 % %$b'@H%$m7$rt %' 0%@ @%@ t$߼߱߿ 0%߰(߱0'`t@%t 0%$4`ߤ $4H߿ ߼$߰(߱0'`' % @0%@ߩ߼߰߿ ߱0%$߰('` %'  0%@ߩ߼߱߿ ߰(% ߱0'`$<$$cb #! $""t$B4$"$"'(<$!a!!0 % %$b'@H%$p7$rt %' 0%@ @%@ t$߼߱߿ 0%߰(߱0'`t@%t 0%$4ߤ $4߿ ߼$߰(߱0'`' % @0%@ߩ߼߰߿ ߱0%$߰('`t % 0% $4@ߩ߼߰(߿ ߨ%߱0'`$$<$$c`@ #! "t$$B4$"$""t$B4'(<$!_!!0 % %$l'@H%$r6$ct %' 0%@ @%@ t$߼߱߿ 0%߰(߱0'`t@%t 0%$5ߤ $5߿ ߼$߰(߱0'`' % @0%@ߩ߼߰(߿ ߨ%߱0'` %'  0%@ߩ߼߱߿ $0%߰(߱0'`$<$$B^p "! "t$B5@$"$"$"<'$B^ "!$% &((% 0 %@(% '߿$D߰%߼'@ %@(% 'D߿߰菐(%&( 3 %$߿ߢ '< $!]`0!!$('% %$c$i<F F 4'*G!BF$@ $g!cf$`0%IׂL׃$mN$p$Oׅ鰏@%t'0%ߤ $5`߿($߼ ߰0'`叉ߨ"! @! DFaF!(CD(F)aF!)B߿(<''!!4&$ $G!BF$@$ɏߣ߼ %߰0'`e$F")Bܐ$F#)Bא$ӐF%Bϐ'< $![@0!!$('% %$c$i<F F 4'hG!BF$@ $g!cf$`.0%ߨUׂ$mg$p$xׂ鰏@%t'0%ߤ $5`߿($߼ ߰0'`"! @! "!@D(DF)a$FaF )BF!)Cׁ`ׂ߿(<''!!4&$ $G!BF$@$׀F"(F (F F D߼ F!(H(%H(߾߼߰'0 $4P,@(C0߿D($0%$d߾ x$P߿'<$BU%  '"!\e#`. '' H$Š@ $' ߤ' H߿ $ x$`߿ ߼߰'@0%$$ x$P߿ ߼߰'@ (%Џ08%0%8%0,B0,$$%<'$!TP!!P ߿߼'@<'$!T!!T %< % ߥ߿߼߾'0(0%  @!$$F0%$<'$BSp"!   %X $$x "@'9@ % ߿tp$lh?D%@ h`$߿ ߼߱'`0(%&( 3 %|$B8B8@@(%|&R80 % 'R E &R (%&8 3@ %|$B8D@((%@%$Uh@ % 'U & & ߵ(ߴ@$ ߰0߲8<'$!Q!!\% T@'9 D Ȯ@߿߼D߷'0<'$!Q!!% $ (@%@H%$$A @$ $#!%)`* *`@%* %AA $BACA`J $& J 3 %$& 3 %߼ $߿%߰߱ ߾'@<'($!P !!'%$ 4 %@70@8H' 4`%@ߵ8T ' % %%4c  %  %ߴ@߳H 4L %&$ 4L߾ % %߿߼(߰0߱ '`'@<8'O0?!' %($ '9 %$ ¼$ @%$߿@@H@%B@Mߤ" Y  D H@ %H0  % %@%` % %B ! $@ %@%`8%0% 'p  ` % $D@ %@% `(%߼8߰H2 ߲߳(ߴ0$ +߿@%J *߱'  %폊߼8߲߱%߳(ߴ0' 'ߥ  $ @@% $HQ K +$'p@<8'M?!''9 $ $( ¼$ @%@0C`ߤ Y ߡ D ߡߤߧ0߿ ߿@߼8'߿@%߼8' 'ߥ( $ ߡ0 $ߣ0C ߧ0D $' <('L?!0$ '9 @%' ¼$ @C@%ߤ ߥ $ @Jt8Q M t"$P @% tt $7"$$'$ . t"P @% tt $8"'߱85      %߿ %߼(߰0'pߤ h߰0߿ %߼('p@ ߱8ଂ t@ $78ߢ@$G 4Ҏ'<'J?!$ '9 @%$ ¼'߿@ @0%$'x#߼߿ ߼'@'@߿%߼'@<'$BJP"! %(%% $$ @߿߼߱'@ 4'߰؎ &R'(% `% %' Ű@% % 4%$'ߴ߲߳' 8߰߿߼߱'@<'$!IP!!  $ ߿@B@%p B( 0 t4 " % $tP@%t@% $80@㬂      %߰߱ ߲0ߴ( 4` %߿߼߳'P߼߳'P߰ 4Ď'(h%$ ,$<`X$cG% #!ߨ$  $ $  $  ߪߪk ߡ(5(!p D߬p@%$ *߭ ߣpc(4h!cm% * ``# a@`!@%$ *-$)i%k)a k X%`  ``# a@ `! $` %%ߥ %|$c8C!B0A z%'9`ߤp Ƙ(%@%,A b $ (%'S!% R @$ #i ,'  %@W  '0$% 4'ߢh@߿8&j ߩ 'xx% %i!0  %߶I%)I!&a $ߥ <'0ߪ0&}߰Π߫8ky 'ߤx %@"+@<1F$9& &@>+`&1!  $ @ %(% 0%'`(%'90ߤp'@%8% F @%`(%0%'908%@%ߤp '@%y ' ߤx@ߡ %ߪ0ďtt $8hF$ &>+ߤ('9p'0ߦ@8% \E `(%'90ߤp'@%8% F ߡ @%`(%'90ߤp8%@%ߦ '@%ߴ߿߷߾ߵȏ4 ݏ' 4t $ % 'ߩphlPHi@P%ߡ(!"ߦ( ߪ(tߣ(tߪ(P$ 0H$I@04@!P+@Fp %$Xp `%ߩ% @!%)`ٍ %J@ 0! ߡ  %  ߨ菙  % ߡ  % (%@%  %P!ߡ&p$$B`HpcF$ i t %߲߰ $8$  \ %߰ ߲ ߡ(p@ߣPh#VߪHl*S % T''0 8ߴ %߱ ߿&tߵ߱'@ %B'@ %'  %߿߼X߳`ߵ߶'0J@Y<4+ ߰ߦ(ߥph'9l % <]ߩ)4$ *!$ ߼X߳`'ߪJ$A߼X߳`'߼X߳`'ߥPߦHlh'9 % <߰ߴ߷"߾߼X߲߱߳`ߵ߶' ``# a@`!-','  %@ZA TC$`304)ߪ@$i$1)1JCP% i*߹( %9̏9 ߥbp0! %ߧ(ߦ(% %@@% @%ߨ%j$Ix @@#A@@! .$4-$@%4m$ X%Үo (Dt$ '$'@,'0PH08(%%@% px$$$|<h$7`$8?@'b%5$ "(48!JFV$BTGJR@ߵ` &N(h%Xϰ#xx!@X% @а!`%I)D!B^$ p0%0% <'<$%`KX$*jX%j A$< 5J JP$#CP%C X$bA0! 8%(($C*$`BP*@$,,$$KX*"*` % j#(c`$@&  X&%& k` %C+x )%< @5kSTWE& & 5$"(48!Kf$BTGKR$%@z& 0A 0@߷ߴ߿h߾߶p߳x߬ ߰0߱8ߢ@߲(LߢP'ߣH`@h%ߪP@ߢPBG$ *`@X%X߫X`SQߢP@0%H'H#T HJ@X%PP%F `$ (%L ' ߪHߡJ$#|!$%$8ߵ .& F ' ߤ$|&&ߪ@ $8JP*@Kk($a$FU $#t@tt $8|$$8h%@X%B0K0ߪPgIP!,G,$ $B `$ 'pX)a&%% %|$8 G!B|$8x0U0$h0A@$H0C$0U(0C 0A0J00J0I0I$%$p`0J< 0J 85)IH$@'X % x'Tt` %% T(!T`e %4 (!` %T(! %&1'%%%  % 2 @&B0'菃t'$%,JW$c8@C!C`ߡ@` % (% <0#%ߴpߴp'' 0%'ߦp'' ,'ߴp4ߡ8 폙ߴp鎔$ߡߴp ߣ `ߤ` ˄(%@%ߴpَ<ߡ8 ߣߴpӎ ߴpЎ4ߡ( ߡ ߴp0ߤ ˄(%@%ߡ ߡߴp,ߥpߤ ˄v@%ߩ@ ߡ(ߴp0pXߡ@ ߡ(ߴpߴp4ߡ8 ߡߴpߡ@ ߡ(ߴp  ߡ8ߴp$ߡ0 Oߤߩp)$ *$('8%ߤp @%'JP!'=@ߴp|(ߡ0 7 ߤX@4X1@%qߴXߦp'' ''ߦp'' 'ߴp^ߤp܌ XD @3'P,ߴp܎ XD(@Nl@ %'@'<'8 '44C#ߴp܎ XD,@Lߤ 'h@sDߤ 'p@yDߤ 'x@>Dߩ)$ .*㏙ %ߥ l'@hߪ@Ï 4ߥ % X$ߦ@:߿`Cߩ( |8 %ߥ l'@<$`t4 ߥ T' 鏙ߩ  ߥߦ % ˔ߧ@,4ߤ '@lDߤ '@4 %ߥhߦ '@d'ߤh 'ߪ@!@qLԯD %ߥ '@߿`$߰߱'Џ %ߥ l'@ߩ <4 %ߥhߦ '@ ߡ <߿`$߰߱'߿`$߰߱'Џߥ % X$ߦ@߿`I`ߪ@D߿`$߰߱'$߰߱'߿`$߰߱'Џ4 %ߥhߦ '@ݏd'ߤh 'ߣ@!`Hm@߿`$߰߱'ߩ {ߣb8߿`$߰߱'Џ %t@%$<ߦ $<߿`$߰߱'߿`$߰߱'Џߥ % X$ߦ@߿`I߿`$߰߱'Џ %t@%'ߦ $=߿`$߰߱'Џ %t@%'ߦ $=(߿`$߰߱'ߩ 8߿`$߰߱'߿`$߰߱'ߡ @߿`$߰߱'ߩ P߿`$߰߱'߿`$߰߱'ߡ 6ߩꯧ4`6ߪ毧<߿`$߰߱'$߰߱'߿`$߰߱'߿`$߰߱'߿`$߰߱'߿`$߰߱'߿`$߰߱'߿`$߰߱' #ߡ8@R@߿`$߰߱'߿`$߰߱'$߰߱'߿`$߰߱'$߰߱' 2<'% %(A$<P0! @ %e t t$>t%t@%t0%$=ߤ $=߿%߰'0,& ߿!߿$>߰'0'% %<@%%'<l6&R\h&s&1*! G&Rhl!c0%p$%%`Rh%hG88!8$$B$%)!hhK`* %'l@0%'h `%@(Cl$ $`ߣ*'$ 4c&RGGAA&1A *#K®A`&RG KAAK&1G߳߷߾ߴ߿% w߰*#߿` ߴ߲߱t߶$> ߵ'@%$ (%'pq# ߤq!߹'px!hpihtx0' 'p j@%ߣ߿#` 4@ %߿߲߰߱߳ߴߵ߶%߷߾'@ &(@@ @@Q߹YX @$@ @%R0%&ehX$D( B %߲߰߱߳ߴߵ߿l߿߶߷߾'@߲߰߱߳ߴߵ߿߶%߷߾'@߲߰߱߳߶߷ȏt߾%$!>ߵ'@߲߰߱߳ߴ߶߷߾t߿$B=ߵ'@%P T&vhߵ#2ߣ10cu %&(0% %@%'0h$`%$ <px%$*)%8H@$|$' أ@ ߿H @!1?t&ߴ@߰8%ߵ` ߴp>H% ߰h߾x'В*&8P$-<@$>6sH&(& %$0' ń%A2+@%, % '$ @$C a0%c0a$+!@ J0c&  j!cs$` %&&@ @!@$ %d'X &8߿@%߷^ |J$!8 H!H!)&Xj!cs$`  %&&@ @!@$ %$0' ń%@%߿߶(A6 @U(I1 | |`|ߨXfߩX1) |ߡX0! $C | '߿@yߤXK0ߤH&J*!!3$ %&&j!cs$`%F8߱ ߳H߰hI $Bߴpߵ`߲Ht߾x&?P%߰h߲P'ߵ`ߴHt߾x&R?X%߲Pߴp'ߡX ߰h߲߱P߳ߴpߵ`tߣH߾x'$B?0b%$$߲P߱&߳$$Hl@&$>8  %@%^F߿@PI$>2_ߴpߵ`߲Ht߾x&>P%߰h߲P'ߤH@%t''߱߳ $>߰h߲P߿ߴp%ߵ`߾x'Џt@%t'߳$?߱ $?߰h߲P߿ߴp%ߵ`߾x'ЏߤH $>H߰h߿ߴp%ߵ`߾x'߰hߴpߵ`tߩH%߾x'%>h(ߤHt@%t'߳$>߱ $>߰h߲P߿ߴp%ߵ`߾x'Џ,ߤ<@@$# ߿&߲P$ >$ -(%< 4 A#!!$$ iI$$B$(H @!@$i`'p8' $#$'p0$#$!@V#H%%D!&R`XPpxh|($ (&8%DA$EC`$B I  %D$'ߥ  0% %$' < % %$' < %$#&&RD3P %$' < %1* WTT%b&s bT$`$ % %@8'e <$ %$' < % %$E < %H %$' < %I0! C`I-'ď1!@!1$<)$ i$' % < %$# %$ߥ < % %$E < % %$ߥ( < %$#$ @ %&S `(%@&*&s&R􏙁T@ %`(% $ @ %$' < %T߷x߱pߵhߴP߿X߳`߰H߲0߶8߾@'  %@j % %@(%$ < %c %$' %&R& < %rT'Ќ% %'9 @ %߿0C0A$b$+  &14D  0%2%@ %,HA ߿00(߰%߲߱'0H 0A 䏙C $g,A[ ,C`,G,H,A $4"$D  0%@ %2%߿4$D &0$@ %߿'08X%  TS(t! @`%4 4  % $!2E&R0% ߢS%H444~`?B@%4P4F8#%ߦߦߦߦ&RS"%&1 0%$ߦߦF$a8%ߦF$a8%ݮ߷H߾P߱(߶ (H߲ %$$$ %(ߥ`3% e!(D8!$$$&12#( $@ T*(EH!($T`%!  %@%@ %$( %( %( $` %ג(߱(߶ ߲ߤ߷Hߵ@\߰ߴ8 ߳0߿'p$` @ [<'$!!! ߿߼' <'$!!!` ߿߼' <'$!`!!d ߿߼' <'$! !!' 4%$(% <' ߤ ď@% 8'߿߼%߾'<'$!!! $8߿@4߼'4<'8%$!`!!  (߿߼' %',x%<$ $c #! $ hxp@ % ɼ(%߯߫ߨߪ߮ߧxߥpߢߩh߿$  G$N$%$  R$ $  sH#8߰F4S߰H  %.߿߰F(`F, g`! `C` hpx߭1!%ah pxHh % ߩߤߥpߦ`ߪߩhHߧxߨ*H#8! ߪ߿߼'`߰ȌF,H  %߿`߰ȌF(H  %߿ȌF(߰L,`F(F,hx߭p' %8$  ߨߪߧxߥp߮ߩh4@0%߮F$ % ߰߿p%'pT$`%$ <,$cP%% %h #!d Џ` %x ɼ(%߮xߦ`ߢߧ߿ߪ$ߨM$ $ $ $ T$ YafvL0!0 ! +!C$D!`%! #, 1A `+3,  !*%%`%&R!Tq!`*$ H0H#@@%8%ߥp0%ߤh^h* 0 &R߿߲߼߰߱߳ߴߵ߶߷߾'@$$ L%'a L,(L*,%%L(,4@`Hߤh@0%ߥp  H%߼߰߿߱߶߷'@ (%%׌(,ߧ`'$8 %  ߧߨ`ߪ4ߨ'P<,$B%% "!߼߰߱' % ΐ @S `ŏ,(-$ )48 '$ 0 %  @, C4!# '$ %B8 %  ( ߿'$ %(   %,߿߼߰߱'8 '$ 0 %  @('$ 4 %  ߼߿,߰߱'!(! k QKP#$d PCH98#80! # ``􏙇`' % $'$L %  (H(H#$ H@84 @!?8!(8C@*( 0*( t((#(@ !d!C * a*b v?#@8!x!xC*?h p*'ph  % $x'$I %  ߼߿,߰߱' '@0% % Π (%@4 tt $?/'@<($BP "!$80% b%$)00#'' @(%@%I߿@ % H(%@(%@$߿@ߨ$## @%t'0%ߤ $? @%t'0%ߤ $? 4@ %߿@߰8%߲ ߱0߼('p<F6w ("Bh!C!߼(0 ߱0$ $)0$(߰8%E ߲ 'p߼(߰8 ߱0H ߲ 'p%H '9/ 'H<0$Bp("!$@8% B%&%$)0h%$8 '' @(%@% ߿H߼0 ߱8P ߲(&P ߰@'` % ̸ (%@<F7w_ 88!90!F߼0 C߱  ߰@Q$߱8R($_ ߿HAB ߲('`'9/ &< <F'4BwX%$c" #!c$%)0l b(߼B'0%)0h%pgtf $@߿ߢ߼'0'p <F<`4Bwh$cp%"#!@߼h߰`'ttxp $@ߥp߿xh'x$ ߿x'Ќ <F<4Bw$c%"#! $c` l   % 4( % ߿߼߰'0tt $@@ߧ߿$$菄'$ 3$)0菄$$)0 3$8߿'' B$<$!%@ !!C "8 4 '99% h߿ ߼߰߱'@H%@%$$$ g@%$% 0%  gߤ⏙'H @8$#<(0$c%"$#!p %(%@0%' '@0'99 % h(% $,HGDCA ߼0_ ߿H߰@߱8߲('`| %(%@0% '@ ߿H %(% '@&'99 % h(%׏t %(%@0%' '߱8@߿H'93'ߤ 'ŏ߲(߼0%߰@߱8'`߲(%߰@߼0'`'93'ߤ '' <0&1 1!%$,% (@%@%BA (%0%X  %@ ߲'99 % h (%߿ ߱߰ߢ(߼0'Pߤߦ('93߱߰ (%߿ '@h`H80@PxpX%%( !41 זטהך#`/`%3$dF ц8%NjPF FnjP``@%$(bH%@+ *-+P#&D Mh#( X#DF!!D(F%F6!F)aF8F4)BF#•$Le(F0#* Ld @#D&,DFX(#FD8FaF4F&<%/0!(F9F8B"*D #$eFX.@%@%F69h%F FH#F 2F DH%FbF!BD@F!L" #`F)DF@!LG:!F #F!$F%BD% F$F&@<b #F!BDF!L"#`F)DF!LJPF #F!A$F%BD$ F$F&<j #njPFbFbh%F F X%F :@P% @%F \2J#DhF! L!F6FkaD#F02D(F8kBF!#LQ!F)aD`F8F4)BFc!F L(!x#F4cF-kBD(McaF(#߲t$ @B GHJ @=tt$A8߲ %ߩ(ߪ@ 8ߡ0ߩ8 ߣ ` 5 4` %߼P߿h߰`%߱X߳' ߤH@_tt8%$@ߤH $@$ ߪt߲@(ߡ0t@%t0%$A(ߤH $AtF$ȏ߲ t $IHG%S$FE $)h@%''$8 @% >߿h߼P߱Xp ߳P ߲߰`'߼P߱XP ߲߳ %J ߰`''9C Sp'ߤH F&@%@%,A@0'􏙀''''$@0% @߲ߩH  8'$ ߡ tt $AX߿h@%t'0%ߤH $@ꏙ 8'ߡ'@<0$Bې("!( 8 *%L0' (%` $߼0߰(P߰8@ ߩߪ߿ _߿@J'" %t@%t0%$Aߤ $A߿@$߼0߰8''9C ӏL<' $Bڐ"!(%% $c)($c8'9)9dߤ' ߤ@@%@߿( ߼ B߲B'@($c)$c8tt $A<' $B"!(%% $c)80($c8'9)9dߤ' ߤߧ(ߦ0@߿8A ߼ "߲!'`80($c)$c8tt $A<' $B"!(% %($)d' $8߲@%@ ߿( $߼ ߰'@tt $B@߿(tt( $BߏߤH | 4 %ߤ߰ 4 ߤ߿('PhH<@$B8"!(X%P%%0 A%`$)د'' $ @%F ߥ0` % Πߴ`߼@߰H߿h߱8߲X߳P',''$ ,, '@H%@P% @%@8%p0%@(%` % Ϝ @ߦp 4 %߼@߰H߱8߿h߲X$߳Pߴ`''9C ' <$(@%$@%&) 3 %$& 3@%$L 3@%$&8 3@%,' `%|@(%$$ %@%&( Ϝ0%' `%@(% %$$& Ϝ@%' `%@(% %$$&x Ϝ@%' `%@(% %$$&X Ϝ@%' `%@(% %$$&8 Ϝ@%t`% $Bp@(% %$$& Ϝ@%' `%@(% %$$& Ϝ@%t`% $B@(% %$$& Ϝ@%t`% $B@(% %$$&X Ϝ@%' `%@(% %$$&@% Ϝ߳߰ % $߲߿߱ '0'@480%H L%P $$D@@%@@%P%8@ߵ0`Mߵ0<' $ H%8%'(<&M5&M '$  $߿H@%%@8%,߲P#$$  |< ߿H" ߰8@'8!$H(  %߱@''9a l(%$#߲Pَ$  ߲P߰8 $H' 8 %(#@<(*0%61 J%D %$#(* ?%E!BQ$@ &e!cq$`@ %& %@-x  %َ$ $@$` $ $ $T@ꐁ$߰0߱(߲@߳߿ߴ %ߵ8߶'`` %' '$TCϒ߰0߱(߲@߳߿ߴ ߵ8߶'`'(0 #%8"*%<  R61D(@ %$p`%(#` $ @N(#0*?%`88!8$ @` &@!@$`&`/%%a$c$B f$c$Bg$c$Bh$c$Ba$c$B f$c$BTa߰0߱8߲߳ ߿ߴߵ߶('P%߲eH#߳ (%$ߴ P%0X!߿ )1"@ % B$$@% H%d% )(#`(%AaAaAaAa$B$cDA`0% 8%@H%(') @#߰0߱8߶(h@# ߵ'P@ %젡'0(8% '%@ ''H  %@%` %  % B(!$ ! $@%' @ %Q ! `(%߳(߿  ߲H   ! %߿ $ ߱08! ߰8ߴ@'p %߿ ' %8@+  ،H%$<$ ߿  D   % %߿߰'  % tt $BЎ  돆'H%@%$% $$% g@%&@'$$' $ H%8%'0(%', '(< 5$@(߰߱ g@ % ߲߿Џ ߿ߢ'$ (ߡ߰@߱h菩$$!叙T %''  @Ꮩ̏`.Dߥ !ߥ @"ߨ% @*ߩ%) '8(% $߰@߱@$bD߰߱| $$؏ 'Џ'' %$ ߿ @%߰'0 @ %߿'0<A4$c%(@%%#! 1'9E( %@(% t$0 @%1$ V $؏00@%Q@%@8%ߢB'  %i %o b  %@ %' |'   '9Ip \@ %  %$*a $clߤ'0`0% !'9G % @(%@&s4!"B0  qD @(%@= '9Ip % \@(%4'9LP %@(% ߱߶߳'9Mp \ %ߴ( @ % $D@ %@(% @%%߷#߲ '9q0 L %߼߿0߰ߵ'Pߤ'9Np$@0%@(% Ӝ@&*a߷' 8߲ 䏙'9a % l@(%Q 4'$(% <'$'( <'' $ '9Ip % \@(%'<$!Ő!! %%%% Y@%@@%*c`9$Xhx`&p&w$daЏt0%% $B@ɏ % X$ 0%&R@@%&@!@+ߩX$-! $ac@%'80% %@$d$&&RhXhx`pߩX&T4H* %@4H!% ˎ0`!&APs `cwDd (%T@s @` %  %w %  %ߨXߩP% O  % Ďt@%'9E %0% t%'9G@%@ % (%'9Mp@% \ %`P?'? 4'$'X' < %$(%' < %ߡh $'p' < %$' < %ߣX*`߰`ߴX#&߰@!!!&߲&$'H'`&s& < %$' < %t$߳߰`8ߪh''9np`(%߲ H ߱ ۜ% 8'ߡhߵ߿% [ߴ߼߳߶߷p߾x'D'@ @tX&R߼߱߳߿ߴ$ߵ߶'߼߰`߲߱߳ߴߵ߿߶$߷p߾x' %t@%$B $B߼߰`߲߱߳ߴߵ߿߶$߷p߾x''9a l %20t %t@%$C@ $C ߼߰`߲߱߳ߴߵ߿߶$߷p߾x'4'4P'( (%$p% H@%'0 ;%0%) 0` %'(( H%44K N4 < %t$0% Ռ$Cx` `%t %$  ߼߳ߴߵ߿߶߷p߾x' %@%t'P0% $C߼߰`߲߱߳ߴߵ߿߶$߷p߾x'P4'`' $'h' < %$'' < %$tt $C h % % ` `% 4'$' < %ߨX@* ߴX#&߰H!!!$'H' < %$' < %&$  % ď@% 8' $[`7 % h %D` % p % % p %߼%߰`߲߱߳ߴߵ߿߶߷p߾x'@&Np'0 $%@ '0C'8% Ӝ%@ '0 ;%0$c0t % $ %$ Ӝ%tt$C$C$  8 $Dȯ@ % ߥ8$ͯ % h %t($0% %$Ch ҈@%@(%  % %$t0%@% ҈$Cx<@8% %t$0% Ռ$Cx'<'0?!P '9E$% tH@(Q@%B X1#8"*`$x <H6R@;&Npfc &(#P%e(#`!X%*0@ 0% B%J$@G (@%%(%AaAaAaAa$B$cDA`P% 8%G@H%(H'G)Ic fw4@#%h#c &H##H* V % %'' %WP& P+ 0 *c@ #!!2$ * 8@ &18!8$@*&1@E% X%h%k$ci%k$c a%k$c g%k$c h%k$ci%k$cU h%q$##%& Ӝ(%@wߤ 4(%c f'9Mp \` %߼߰@߱0߲`߳PߴHߵ(߿߶%߷8߾X' X%`0%@(%'H%'x@(% R@(4$0'$ V4􏆀8%<@4 $b U44 x't48 x$D@t4< x$DP߿@@߰H'`%tt $DՏ%8<'$`#$!߼'௠ ߦЏ4'$8$ $ 8%'0<' 5', '( @ ߿  ߿߼'$$ ($# , x](%$ r't$c%L %K@%B%JX%%$E ,#"* Kx!"?2I%C$B`G$BH$BA$B C$B`G$BTC$ߢxߣx$##*%%' "$-ߣx$##*'% ($- ߿߼'% %$@ 0@HPXߨ`h 4'8$' <'8$ߥ <'8$ߥ@ <'8'9P ߤ߮`߭X߬P߫H$cߪ@$ r@ߥ00 ߣ`t$'8 <$D$ߥ <'8$ߥH <'8߮`߭X߬P߫Hߪ@$c$ rߥ0$ߧX 'ߥP 0%$' <'8$' <'88ߥߤЏ<'9npH%8 ۜ%Dߤ 8'8߮`߭X߬P߫Hߪ@$c$ rߥ0, )4@( ,B(@# G$H$p(A08@HPX` ߤp $D@ %ߢ8ߥp D߮`߭X߬P߫Hߪ@ߢ8$c$ rߥ0($g$H$ߣx$E##* I$-E$nY߹$s\v%C`$BG$BH$BA $BC`$BG$Bߡx$E@#@*$-F$eG=$iHCII$sAs%C`$BG$BH$BA $BC`$BG$BDߤߥ ߮`߭X߬P߫H$cߪ@$ r@ߥ0ߧ ߣ$ @&$( $ g&$ ߨ$ #&$a@ ߧ$ @&$(8 $ g&$x u%@HPX`h %$0$ '4߹߸h߮`߭X߬P4ߧ߫H$cߪ@$ rߥ0$  ,bxv%ߧvߨF$08@HPX` ߤ $Dߩ8ߥ@ % " ߮`߭X߬P߫Hߪ@$cߢ8$ r(ߥ0@HPX`0xߤ0p'(' $ ߸߯p߮`߭X߬P߫H,x$(H@&ߥ0@+8 ($cߪ@$ rF@HPX`0xߤ0p',' $ ߯p߮`߭X߬P߫H,xߪ@$cߥ0$$ r߸H8&,% ߡ t$'8 <$D`߮`߭X߬P߫Hߪ@$c$ rߥ0q$08@HPX` ߤ $Dߦ8ߥ@ % ߮`߭X߬P߫Hߪ@$cߢ8$ rnߥ0@ ߤ@ߤ  ߤ ߥhߧ@@% ߥ$'8 <ߧ$D pߤD pߤ߯߮`߭X߬P߫H$cߪ@$ r*ߥ0%8(ߤ0%ߥ` ҈$@(ߤ0%ߥX ҈$@$' <'8$ߥ <'8ӏD$' <'8$ߥ <'8⏙('0( %$$$ g%oߥ0 %ߦ(߫$ $ߪ  $ߤ g߾߿'p<'%$!&!!4%(%T@(  $D2t@ % $D$$߿%߼߷'0߼'0'<'@?!'9E$% t'9Ip@%@ % \'9Mp \ %0߾% 0 '9q0 LH % Ӹ$߿߼߰'0D %菙 A $<$PC$!%'<  H4d$%'% 4'0 ' % '߷@؏4H%$ߵ$ ' 8߾߿'' |<$B %( '"!' (% &@%`߿(0% (%  @(%'& ߱$߰& ߿(D ߼߰߱ ߴ '@߰'9t0  %֎' |<@$B0%P D"! (%& @(%@3߿PH%@%$$$ g (% t$ߤ( $cH8B g0'ߥ0 &ߦ8Q H ߤ0ߢH$$C( (%ߤ '߿Pߦ(@(%F ߼@߰ ߱'pG('9t0  %'H(0 (%$@%$| %&8 3 %$ % 3` %|$&R&T` % (% 'V &RT&1` %  (%@ %' EQ 7$VV߰ ߲߱H߳@ߴ(߿0ߵ߶8߷'`'0( <$!9-%%$ @% (% %$H  %tdJ$H @(% %$H  %tdJ$H ߿0߼(߲ ߱߰'@'( <$!9-%tdJ$$ @%@ %tfJ %$/ T@$P %(%$ ߿(߼ ߱߰'0'( <$!<9-%tf1J (%$$ @ (% %|d $8 8  %|d ߿(߼ ߱߰'0' P%<$!%%%@2!!(@% @@%p$  @ I0@%1$ 鮒@߼߲߰߱ ߴ('`0 $ @%߿0 ﮒ0( $ߣ߿0@%bP%<'$ ($!` !!"E #f (< P%)  ߼('` )" @% 00E   %߿0߼('`<'$!!!% $@ @߿^@ߦ`F߾@߾D D߼'0<$B"!(@$ '  d '@' 0<H$!@!!@P8%( (%  %1  #%%`GH@@% %@4 @DT D  %%$<$"|<$! Dx !!1%e&+È XD@%@%$@ ߿$ߴ߼H߰8߱@߲P'pA0! f߼H߰8߱@߲Pߴ'p9(%$% HH$!@H߼H߰8߿߱@߲Pߴ'pB(@+@D  < 4c0#$`߿@ % 9x(%@߿2& ܎(% % ; @%@j߿2!| 2" @B  % X(%,C0߿ߦ0(ߧ(ߡ  ߴ߼H߰8߱@߲P'pD pߤ ߿ P@*@%߼H߰8߿߱@߲Pߴ'p0 `$ % (%@߿${(%<' T @@<2C ` %p߿  %$ҮC0ttX%$tP%%)K$J $J莅߿4 ȮD pߤ ߼H߰8߿߱@߲Pߴ'p%@ Cq$`H Y(% D@߿<&' ߿8߼0$߱(߲ 'p!0!'`'XaH I߼0%߱(߲ 'ptt@ %P%t(%)L$L& $L߿8߼0$߱(߲ 'p1 ߿8&@ % 4,1߼0%߱(߲ 'p@ % X$ߦ@߿8@ %@(% ߦ߿8߼0߱(߲ 'p߼0$߱(߲ 'pߦ@ % X$%@ h@ %߿8 @ %߿8t@ %t@%$Lh& $L߿8߼0$߱(߲ 'p@ %@(% $߿8߼0߱(߲ 'pߦ@ % X$%@߿8F߼0,H߼0$߱(߲ 'p'<'?! '9% ( %ߣ0!+%#a߿Ȏ'((g Џt߼߱߰߿߲$%M0߰' U %ߡ S4Cl؎ (%`%$X%tP%$ %$$ L $$&H@% :$$d$ X%@Fߴ$$$C$$GHNߨAߧt߲$cM t@0%'0 $MЏߤ0%'0 ߲߿߼$߰߱'߼߰߱'ߨt߲$M`'$$ ' Mh$ ''''%'( (0! !4cH%%$$0% ߴ@ @%l (%$t߲$M­ '9@ߥ % ߲Ў (#(# $%@ B " '9p % \ (%߿߼%߰߱' (%'90@%$ $ '!<$B%$"!߼߰߱'@ '9 ( % '9p % \(%'0 ߿ $$$#l`(%$B (% $ '9@ % ߥ߿ % % ߼ ((" ߼߰߱'@  %'90$8% $߿ '@%E 0 $$l`(%$B (%  '9@ % ߥ߿߰'0@ %'90$$ $߿'80<(&s@3!4 %%H %% %$$$$$DiC&Ø Ao $$$$F$G`xAgE4C2߼(߰0߿H߱ $߳8ߴ@'`<s4!$Aߣ#&߼(߿H$@ߧ ` ߼(4A߼(@$C$"@0ߦF.߼(߰0߿H߱ %߳8ߴ@'`3`|3쏇|0E\0$ P400!9ߧ$ % `(%  % T$߼(߰0߿H߱ %߳8ߴ@'`$߰0߱ $߳8ߴ@'`$$$"@߳ߡ"@%߼(߰0߿H߱ $߳8ߴ@'`߼(߰0߿H߱ $߳8ߴ@'` '9 ( %ߧU3ߡ3㏙$ % `(%  % T$߼(߰0߿H߱ %߳8ߴ@'`ߧ.$ % 匎%쏙  % T$߼(߰0߿H߱ %߳8ߴ@'`ߣc0c`bߣa r4p4߳߰0߿H߱ %߳8ߴ@'`߰0߿H߱ %߳8ߴ@'`'0߼(߳8ߴ@߰߿H0$߰0߱ '`! ߡ3%$X%P%t$ $`$ $ &s@Ꮩ '9@ % `(%H%ߥ$$$0% @l&4ή&(% $߼('!C!@"!!%<8$c %0" #!$ ߼88߰@'`d'Hߤ0 '(ߧ0C# ,#$(߿H$!08 !H#<$ #H(#%* *@@h!#*`D0!0*ޮ$'`( $ <$ 0$!`8!!%%%%% %jHX% @ %'9@(%' '$`߿X@J@PE$@K  %(% T%`߿X(L$AQ  % %# %(% T%S1 +&R`$ ﮐ$ %$ 4  (% %߿X߳`$߱PP`@(C$BP`*@%$$0#` &* %(% T%% $$db! $! $ %4 (% %$߿X߱P` ߿XᮓߵH %(% T%߿X߼0߰߱P߲8߳(ߴߵH߶߷@߾ 'HXf$߼0߲߰8߳(ߴ߶߾ 'C`@J  %(% T%`P߿X(+$!Q `G %:%@C` $J  % T(%P@߿X@ P`$(K$B`c@%$L$0`P@b `P@; $ %$4  (% %(% T%S 1 *&R@$ 쮐+߿X߳`߱P`PP`P$jߵH %(% T%Pr߿X+&` $, %(% T%% $$db! $!  (% %$4  % %L߿X@I߿X<ߵH߱P %(% T%<߿X`P@ `P@^ $ %@(%4  %@$4 %(% ߵH %$ %4 @(%?@$ %4 @(%U $4 %(% ߵH %4 %(% % ߵH߱P'%%%! >%@;F<s\4!DEC c !!d!c$ (D'|,'x't'p'E%,%(D%@ $ ߭0%$߮$( h+L 8 p+ (%@ ߮' 诮@߿߲߰߱'߲߰߱''<$!z%!!Q ߼q %%0"߱߱߰'0 %߿'9 ( %߿! 'D 䯤 '' H$ $ %@ $ %@$ߤ' H߰ ߿'@$$ $ $8% " f#`$$%0쌧'%% $ @ %Q$!A   $߿0߰߱'0'<$x %!% XD߼߿߾'0$ %P%A4!0#`AJ @h%$  P%(%K1ch%` 1h"J @$h%(%P%$ IB&,H$,c1!X  IJ @$$$a&aX @%X%$8% $ 8% $0! $ $<'%$!vp!!((C 00%߼' 0 ߿߼' ߼' <'$Bu"!T  ߼'0% $$T $Џ( (%  $߿<'$u&!  0%$ $߿T߼' <'$!u0!! % ` %߿@@%%߼߳'0 $lS @8%$$Ƨ 긎d߿ߢ߼߳'0'Ќ<$!t%!!    %߾߿߼'00<'$Bt0 %"!< D(   % %@'( 8%ߵ(߱ ߴ߿߼߰'@߼'@0<'@`$Bsp 4"!h<(xp Dߵp %` `%@@%%'@ @%'(% T %&'߱xߴ߿߶߲߳߼`߰h'߼`'<'Px$!rpp!!D`  % % $@%@߿`  % %'` `%'(% T%&R2 %߲ߴ߿`߳߼x߰p߱'$ $ h  %D  %$  ߥh߿`<'0$!qp !! ($ %@߿($߼0߱ 'pߢ@|H$(%&*8  %ߪt@ %t@%$O& $Np߼߿߱$߲߳H'Џt$ߦp $O@߿ߩ$ *߰t@ %t@%$O& $Np߿߼$߲߱'Џt$ߦp $P8@߿$g$ߦp' ߳H@߿ߩp-) ߪ$A!߰t@ %t@%$P& $Np߿߼$߲߱'Џt$ߦp $P@߿$' ߦp@J߿$i$' ߦp@߿ߩp-) ߪ$S ߰ߡ$#ߪt@ %t@%$Q& $Np߼߿߱$߲߳H'Џt$ߦp $Q@߿~$' ߦp@4߿vt$ߦp $R@߿mt$ߦp $R@ ߿dt$ߦp $R@ ?߿\$mt$ߦp $S@S߿ߩp-) Oߪ$S ߰ߡ$# ߣt@ %t@%$S(& $Np߼߿߱$߲߳H'Џ$' ߦp@߿1$o$ߦp' ߳H@(߿ߩp-) $ߪ$S߰ߡ$#ߩt@ %t@%&$S߳H $Np߿߼$߲߱'Џt$ߦp $T@߿ߩ$"<߰ߪ$Aߩt@ %t@%$T0& $Np߿߼$߲߱'Џt$ߦp $TX@W߿$rt$ߦp $T@߿ߩp-) ߪ)J߳H@߰ߡ$#߱`1 ߤP ܴ%@(%@ % 4`%1 ߳H߿߼%߲߱'Џt$ߦp $T@߿ߩ$߰"߳Hߪ$Aߩt@ %t@%$T& $Np߿߼$߲߱'Џt$ߦp $U @߿$ s ߳H$'( ߦp@߿ߪp-J@ߡ$#߰t@ %t@%$UX& $Np߿߼$߲߱'Џ$'H ߦp@߿$ t o$wt$ߦp $U@f߿ߩp-) bߪ$S2߰ߡ$#ߪt@ %t@%&$U߳H $Np߿߼$߲߱'Џ@ %t@%f,$N߰ $N߼߿߱$߲߳H'ߤPߥ`ԌL @߿t߼߱$%)SI߲'ߪp-J@ߡ$߳H"Z߰ߣ$ iWߡt@ %t@%$OH& $Np߿߼$߲߱'ߩp-) ߪ$߰B?߳Hߡ$#ߪt@ %t@%$PH& $Np߿߼$߲߱'ߩp-) )ߪ$߳HBx߰ߡ$#ߡt@ %t@%$P& $Np߿߼$߲߱'ߩp-) Aߪ$߳HB߰ߡ$#}ߡt@ %t@%$Q& $Np߿߼$߲߱'ߩp-) uߪ$߳HB߰ߡ$#ߩt@ %t@%$S؎& $Np߿߼$߲߱'ߩp-) ߪ$Bo߰ߡ$#[ߩt@ %t@%&$Th߳H $Np߿߼$߲߱'ߩp-) ߪ$B`߰ߡ$#uߩt@ %t@%&$U0߳H $Np߿߼$߲߱'ߩp-) ߪ)J@߰ߡ$#4ߢ`B@@ %߼߱%D߲'Џ '9ߤP (%߿߼%߲߱'ߢ`BD@`ߪ`t@ %tH%H,$P & $P߿߼$߲߱'"eߦ`'@ %% %@B߿߼߰$߲߱'B,ߣ`%  ߩ`#X$ j$#Xߡ`"4B"0C`>߼%߲߱'"1@ %' % @߿߼$߲߱'B \@ %'\ %߿߼߲߱'Џ\''߼A Q%߲߱'ЍC0c@H$ `I߼%߲߱'ߪPJ''߼*H ߱%I߲'ߡߤ`" ܎%  = %  % $Dߪ`ȭB@ % % ߡ`!0! b߿ߤ`' $ $@Z߿ߤPߥ`ȌL'   M߿" '@ %% l`%@߿߼߱$߲߳H'Џ'@ % l`%@J߿߼߱$߲߳H'B$  $a@%p$ p%߰i߳H$ ߦp' ߰@ߡ`$ * '9 ߤP߿"ߩ`% `eߪ`B$ I?I"ߪ`% `m,ߥ` ߤP Dߩ` ߡ`*$CP$l*"ߢ`% @x߳`jX$AP$jX߳Hߣ`b4Bb $  $Dߣ`Ȭb@ % % ߩ`)1) ߿ߤ`'$ $@߿ߤPߥ`L'  ߿"ߢ`% @_߳`jX$AP$jX߳Hߣ`b4Bbߣ`cX0c` Dߦ`t|x $O߿߼%߲߱' %@0%@ % ΠߥP@߿ߪ`IB 5)I '9 ߤP߿ߢ`''߼B߱b %A߲'@% %$u@%p@H%߿$pP%߰A߳H$ ߦp'  ߰@߿ߩ`#X$ j$4cs#X@% %$up@%߿$ p%߰i߳H$ ߦp'  ߰@߿ߡ`*X$CP$5J*Xt@ %t@%$P& $Pp߿߼$߲߱'ߩ`*$-ߤP$+)l1C %+D1J @ P+ *p ߣPߧ`fp0#ct#Ha @0!H8!0%8%Dߩ`t10H+) $P߿߼%߲߱'ߪ`J1J@ߥ`ߤP ܌B߿߼%߲߱'ߢ`BX0I ߳H'C߼%߲߱'ߢ`BX0I ߳H'C߼%߲߱'Џt@ %t@%$T& $Pp߿߼$߲߱'Џt@ %t@%$T& $Pp߿߼$߲߱'Џ '9@ % ߦP߿߼߲߱'@ %'% %߰@߿ߡ`"$ 4IJ$ P%CP *# $ 4I J$# 4B"ߦ`'0 0,D ,߿߼%߲߱'߼D߼%߲߱'ߩp-) vߪ$S߰ߡ$#Ώt@ %t@%&$O߳H $Np߿߼$߲߱'Џt@ %t@%$Ux& $Np߿߼$߲߱'  ߪ`I1)߿ @߼%߲߱'ߪp-J@ߡ$3߰ߣ$ iߣtt@ %H%t&%Q$P߳H $Np߿߼$߲߱'ߩp-) ߪ$S߰t@ %t@%&$Q߳H $Np߿߼$߲߱'0I ' J0A #' !C@ %'% l`%@߿@ %'% l`%@߿@ %'% l`%߳H@߿@ @ ߩ`"x#|!*X5J*X#@ %'% l`%߳H@x߿ߪ`CdB4BBIhȏ'$ߤP8+ V %ߤPȌL߿'$ V %߿ '9p'ߤ` '' D߿߼%߲߱'ߤPz0 ߥP ̸$ ߪ`I߿5)I '9 ߤP TߤPt߿ߦ`ߦP' Dh߿ߩP) ߡ`tt@ %ߦP@%߳H$R, $Q߿߼$߲߱'3폓'@ %% l`%@߿߼߱$߲߳H'ߪ`JD@ߩ`'0;Asߩ`%  ߳Hߣ`b$ aX$ )$JaXߡ`#*pC#C)#*ti#HCߪPCi!#JCP!*ߪ`$ ItIpߡ`"4BI"ߤP x% ߣߧ`$ @%߿@(%is %h0%%ꌂ0%@@ %hSߡ`%  ߳Hߣ`d<` ߿ߩ`0 <߼$߲߱'Џ@ % X$ߦx@%@%@߿j1J@߳H߳HR A0! U@ %B@BL@5ߤ`C $  $Dߥ`Ȭ<@ % % ߿ߩ`)1) ߤPߥ`L ߿)H ̏t%JUhJ! cߢ`tt@ %ߦP@%߳H$R0, $Q߿߼$߲߱'Џ UߤPߩ`)L EߪS2T@ %'T% 'P ߳H@߿߼$߲߱'Џ'$  `0%@M߳H߰`X߰'$  `0%߳H@߿ߣ`aX$ ߰)$4!zaX'$  `0%߳H@߿߰` X$AP$5J X߰'`@ % l`%@U߿߼߱$߲߳H'ЌBD@qߪ`H,t@ %tH%&$P ߳H $RH߿߼$߲߱'ߩ`)X1) ߳HDߦ`ttp $O߿߼%߲߱'ߩ`h"hH Ӹ$ $@%@߿ &d ߪ`߬hLȍKЬKBЬR߳H$D  %߿ߡ`!0! ߳H '9 4ߤ`߿ߡ`! ߳Hߣ`c$' @%%$H!E0!c$B' ޜ߼߰߱`߿߲h߳pߴx'L0T\ t<, $Xߢ߿1f% '9 % 0 (%߿@'߼߰߱`߲h߳pߴx' '9P %  (%ߩߨ߿L44؎ $߿ L($@$(($ ߨ$ ߿H%@%$$$ g@% S g` %ߢ߿'Ȏ<$B! "!`߼߰'040 0 4 ߼߰'0  ̸$ ߿4'$ <$$! %!!0$l@p#"%P(!0l`{@t#C3Ha!($@%$(@t $##2!8#0 `%*c@i "D"##6!##Dv0 l@0X0!0 0@ '90 p %߿0!T$0!"8!%0`%߶8@C$*8T !<5L@RDs}\0@ <`@%@8%t0%(% $X`H%L@@%8%$0% ߿0߲H߳@ߵ ߴ( 1J@B ߼߰߱'`(%H%|%H@38%%ߵ 2ߴ(S/L@r DS߼߲߰߱H߳@'`\0 H@ %@(%  `0%߼߰߿0߲߱H߳@'`' ȏ$%"$ ߿@@%߰߱ ߲'@ '9p %' 'l ,pD( #h$<tCTC!C#@a"@p\d!#t`((!%p#88!'te"! ! \'`%# @ H`%@$@%5ȎH<8 %a!@!q!@!GPHTP(#Ȍ88!90!H'''@%8% q!2!߼ ߰8߲@߳Hߧ(߿߾߱0'p ߼ 'p@Hh`< PH%JG.H!X*! IX8!%%%`p%)! !i!#!'`񏙀 '9 8 d %B߿88H@ %(%`0% 8%@%''' %@X $L@sCdkHB`p%%ޏ$(I(߿8%*nQ8P<# _Ѐ#A@!* [CD*`Wi E<<83H$%#3+*#E % $0$0 @0 8%`8H8#+X#<gH* 0#* @h!c*`D(H!H* >HTȯ %0%߼P߰H߱@߲h߳`ߴX'$D$߼P߰H߱@߿8߲h%߳`ߴX'߼P߰H߱@߿8߲h%߳`ߴX'P@T0!߼P߰H߱@߿8߲h%߳`ߴX'tt $ZR߼P߰H߱@߿8߲h%߳`ߴX'߼P߰H߱@߿8߲h%߳`ߴX''08$%C$ 3H%@%$$@$ g$'& ̏& &Ď$&'  '\(ȏ߶8 &P'$(% T%@0# '$$$@%H% g %@%(%0%@%@ ߴ0 %`% g߾H߳(߿@߼߰߱ ߲ߵ߷'@u*& &o&s &u ('0(!% @t$%@% % 0%o %߼߰߱ ߲߳(ߵ߶8߷߾H'$$$@%H% g %8@%<(%@ @% % g`%ߴ0hh! i@(!ƌߡ&_ & *[ DL %@ U%߿@@ U%߿@ ߳('9 %߶8(% ߾H߿@%8%H%& +-/&0&$,s@&X&-k`&h&&x&,c- - -M $P -k $H ,! a @%%'<( $Bp% r"!  #0c` 1  ߼ ߰(߱'P$Ȍ0߼ ߰(߱'PL@^0'E' $`%@H߿0O 0%@G!7$BT"@ $@%H% ߪ߫(!e% *%k`%)+ߦ ` `! H(&H!(܏E$ $ߤ ߱߿0 ߿0߼ ߰('P߼ ߰(߱'P߼ ߰('P%ӯ 0 '9!0 L"BL'< $B@% b"!Q  $0` 01  ߼ ߲߱'@߼ ߲߱'@$ȌLK%߼ ߲߱'@$ߥ'(' H%@B߿(8%`' P@%DF!$$%G%)%g*`  % 0F!AA$$(*$ߥ$  % ߱߿(߼ ߲'@߼ ߲'@ '9!0( L&߿(L߼ ߲߱'@'(<$!P08%%!!(% X%P%''' %' @ '$߼8A߿@$"߰(߱0'p"! @h!dh#(C!l@! %#t#b@@!#(C!l@!  %#p#b@@!Ϭ<'0!H$B !"!@L  %$$$0%|G߼H'p'X V$߿X(%$8%쯠0߼H'pP'9!0X Lߤ@ߥPߧ@߿XٌL'(0@ Y%80% P"LHI<"C!H%I4cC5HH0c`<@% ?p %@(%KJHIDH@G 2E߲ ߴ%`/߰0T %' '߲ @M߿8ߴ߱$߼(߳@'pt %t@%8$^pF $]߼(߿8߱$߲ ߴ'p߼(߰0߲߱ $߳@ߴ'p  %߿8߼(߱߳@'p%@^߳@@% %@%&(!&s 4@*U߿8߳@߼(߰0߱%߲ ߴ'pe %  bH*%%,$. % %i0H!"A* &0!1#t&R  % $D@ %  (%cߡp!a߰0ߵH ߳@߼(߿8߱%߲ ߴ'p %, 4@% %4 4@%1%B @I1) %"߰0@߰0 %'( 4@%߿8 %E, 4@% %'<$!p%% $!!(0$.$%*@ 8!&v& % %$&߰0߶( %߼ ߿߱ߴ ߵ'P$'(<$B٠%%% +"!( 0HP@`%8$  % S%&!0 @ % 0% X$%@@%@ % h%&߾P߷Hߵ ߰@ߴ8߿(߶0߼߱%߲߳''%$$ < $!ؠ%%%!!(Ct %t@%$^ $]߼߿(߰ $߲߱'` %( X$@0%@ %@4߿($H0% X$@$߿(t %P%t'0$^ $^߼߿(߰ $߲߱'`0ߦ X$ %߿(@0%@ߤ0߲߼$߰ ߱'`߲߼%߰ ߱'`߼߰ $߲߱'`'%$$ < $!%%%!!(Ct %t@%$^ $]߼߿(߰ $߲߱'` %( X$@0%@ %@4߿($H0% X(%@$߿(t %P%t'0$^ $^߼߿(߰ $߲߱'`0ߦ X$ %߿(@0%@ߤ0߲߼$߰ ߱'`߲߼%߰ ߱'`߼߰ $߲߱'`'H(<@($B`80%% "!T %'|@%'8% $ $@߿H߼0$߰@߱8'pX %t 0%$ $^߿H߼0$߰@߱8'p@ ߩ(H ߼0%߰@߱8'p))ߡ( S$#B| ( %ߥ@ %$ 10߿Hߥ( '&& H %*H!$ I @! $@@߿Hߤ($  #\ׂX( %(!' @6߿H߼0$߰@߱8'p %t 0%$ $_߿H߼0$߰@߱8'p(% 8$@(% <, @ %ߨ0X %t 0%$ $_߿H߼0$߰@߱8'p߼0$߰@߱8'pנ׃F ߣh cDDFa׀FLaL!F MF D ߣ D)!aH ) ߨ vߩ* DFaF"B)DFF"C| % (@ % x׭a߿H'@<0$$B8(%% "!t %t@%$_0 $]߿@߼($߰8߱0'p ߩ$v%*@8%ߡ%Eߣ$wh'@0%@ @%@tߦ  % X$@P߿@߼($߰8߱0'pt %t@%$_ $^(߿@߼($߰8߱0'pt@0% $_X$v@ߧ,ߡ`' $a % X$Kp@^߿@߼($߰8߱0'pt0% $_h@ߧ,ߣߦ  % X$@ ߿@߼($߰8߱0'p@ % '< $K % p% % h %߿@߼(%߰8߱0'p􏆀 '<ߤ $K p %$$ h %t %t@%$_ $_x߿@߼($߰8߱0'p p %h % '$a ܘ$Kpď <'ߤ ($K$%$$$$$"$'$<$$B %%`"! t@0% $_@!߿t %t@%$_ $^(߿߼$߰ߵ'`t %t@%$` $]߿߼$߰ߵ'`(08$  < (%@ @%(% % p %@ % p %@t % p %@ %t %(% h %߼߰߱8߲0߿߳(%ߴ ߵ'`(08$'`hH<`($B`XP%% "!T'@%| %'X$$ % $H$@߿h߼P$߰`߱X'X %t 0%$ $^߿h߼P$߰`߱X'('ߩH!4X % 0%$'X $߿h߼P$߰`߱X't@ %,18%)` 8! ߨHE p|$ ˄$ %'h hB | ( %@ % (% 1$߿h߼P%߰`߱X'$ 8(%@(% X$ %@߿h͏t߼P$߰`߱X'p h %| ( %̌ @ % ߿hp % h߱p1 ߿h$ 1h$,|( ( %@(% % ߦ(1$ 򏙐߿hp h %| ( %Џ@ %$ 14߿hp h %| ( %@% ΐ@(%  %߿hp h %| ( %̏@ % ߿hp h %<8t'D@ $`菙| ( %@ %$ 1'v߿hp h %| ( %̏@ % Dh߿hp U@ %'H'  h %| ( %@ %$ 1'Q߿hp h %| ( %@ % 0B߿hp % h߱p(:߿h| ( %Ў%@ %$ 1/߿hp h %| ( %Џ@ %$ 10 ߿hp % h߱p( ߿h| ( %Ў% @ %$ 1, ߿hp$p$$ '9i0 L@ %@$@ %' ' h %ߣ#$`'P '| ( %@ %$ 1'߿h N| ( %@ % ߿hp%$p h %| ( %̏@ % ߿hp h %| ( %̏@ % ߿hd''p @ % h %| ( %@ % ߿hd''p @ % h %| ( %@ % ߿h'XpF ' h %| ( %@% Xl@(% %@%' 2'`y߿hp h %| ( %00!1(!(@ % c߿hp h %| ( %00!1(!@ % $N߿hp h %| ( %00!1(!@ % 9߿hp h %| ( %00!1(!@ %  $߿hp h %| ( %00!1(!@ % ߿hp h %| ( %00!1(!@ % ߿hIE @ @!A(!(p܌@(%p O %߿h '9i0p L@ %@%@߿h h %| ( %@ %$ 1%,߿h%0! %@0c`$ h %| ( %@ %  (%߿hp h %( @0%'H '| ( %@ %$ 1'߿hl''''p @ % h %| ( %@ % ߿hl''''p @ % h %| ( %@ % z߿hl''''p @ % h %| ( %@ % f߿hl''''p @ % h %| ( %@ % R߿hp h %| ( %̏@ % @D߿hp h %| ( %̏@ % 86߿hp h %| ( %̏@ % <(߿hp'ߥH&& % $@<߿hߨH$ @# ᏙX %t 0%$ $`߿h߼P$߰`߱X'p'ߥH&& % $@&߿hߨH$ @# 5X %t 0%$ $a߿h߼P$߰`߱X'p'ߥH&& % $@߿hߨH$ @# (X %t 0%$ $a`߿h߼P$߰`߱X'p'ߥH&& % $@߿hߨH$ @# X %t 0%$ $a߿h߼P$߰`߱X'p'ߥH&& % $@߿hߨH$ @# X %t 0%$ $a߿h߼P$߰`߱X'ߨH$  }pX % 0%$'X $߿h߼P$߰`߱X'ߨH$  pX %t 0%$ $a߿h߼P$߰`߱X'ߨH$  pX %t 0%$ $a߿h߼P$߰`߱X'ߨH$  pX %t 0%$ $a߿h߼P$߰`߱X'$  pߡH$##X$ 8(%Dt@ % $b@$$ 8(%@(% % X$@%@߿h߼P$߰`߱X'a$X %t 0%$ $b߿h߼P$߰`߱X'K $ 8(%@(% % X$@%@$(1 h %| ( %@ % ߥ߿h$ 8(%@(% % X$@k߿h߼P$߰`߱X'$ 8(%@(% % X$@k߿h߼P$߰`߱X'$ 8(%@(% % X$@k߿h߼P$߰`߱X'H'1! % $%@߿h߼P$߰`߱X'PQ!(% 8$4@0%'  %@߿h߼P$߰`߱X' !(% 8@(%@% % l'@߿h߼P$߰`߱X'| ( %@ % ߿h$ 8(%0@0% %' (@,߿h߼P$߰`߱X'$ 8(%4@0% %' @8߿h߼P$߰`߱X'$ 8(%@0% % ʬ@%@߿h߼P$߰`߱X',%''$ $@%@0% h % X@|߱%) %)H0 !(% 8 h %| ( %ߥ @% x@(%  %!߿h % ה߿h߼P߰`߱X'@0%'p'  'ߨ 'x& '' '$&1( 1h'|8 ( %@(% % ߦ8ߩ@%)@!H* ߤ0 ˄%@'hc' ߤ߿h߼P$߰`߱X'߼P$߰`߱X'߼P$߰`߱X'߼P$߰`߱X'߼P$߰`߱X'(t''& $a  % h %| ( %@ %$ 1'߿h h %䏥 ܴDt@ %@0% $a0@| % (߱@ % (% 1$߿h$ 8(%4@0% %' @߿h߼P$߰`߱X' ܏ XD@%@Q߿h()( M), o h %| ( %Џ@ %$ 1,b߿h| ( %Џt@ %$ 1$b0߿h߼P$߰`߱X'00!10! DעDF!FaF"F! % h| ( %@ % x׭4߿h h %| ( %@ % (߿h h %| ( %t@ %t@%$aߦ 2$a߿h߼P$߰`߱X'$ 8(%| ( %@ %'Xt@%$ߦ 2$a@߿h߼P$߰`߱X'h `@߿h h %| ( %Џ@ %$ 1,߿h' <%($!P,!!ߤ 0' 8(߿0t@ % $^@߿0ߨ)ߤ (% 8ߦߤ@(% X$߿0ߨ@ ߼($'`%߼('`߼('`߼($'`| (ߤЏt@ %$ 1$bX߿0$߼('`<'$c #!t@%t %$Gb $%bx߿$߼'00! % 0c`%%'`$ .$ ^P(<X$c@%H%% #!$x$ xw$t*A Y0$8  $b$c$fp$r$ i $ l $p $sp"I*tt$ߦ  $e0@!ߪ -J@AX&aX#1kaX&aX#`%*C`H*J@Fߦ0` % X$%(@.߿߼H߰8߱X$߲P߳@'tt` %H%t&%f$fp߰8 $f`߼H߿߱X$߲P߳@'t` %t@%$b؎& $b߼H߿߱X$߲P߳@'T` %'l'h % @߿߼H߰8߱X$߲P߳@'(t` %P%t'&%)e@߰8 $b߼H߿߱X$߲P߳@'$' ߦ @x$c$Bj%$ Jg$ Kett` %H%t%c $c' $b߼H߰8߿߱X$߲P߳@'t$ߦ  $cX@U$c&$ .K*t` %t@%$cx $ch߼H߰8߿߱X$߲P߳@'$' ߦ @ $c:$r$' ߦ $c@3$r*J@~&K X %$' ߦ $c@%$r$C6t` %t@%$c& $b߼H߰8߿߱X$߲P߳@'t$ߦ  $d$c@ $r$ J)t` %t@%$d & $b߼H߰8߿߱X$߲P߳@'t$ߦ  $d8$c@$r*J@ߦ0` % X$%@Ꮩ$߼H߰8߿߱X$߲P߳@'$' ߦ $c@g$r$ sp֏$' ߦ $c@$rߡ ,! WJ&j#W0cj&j#$ $ `*K`$ %t$ߦ  $e $c@$rߪ -J@$` %'9`@(%&' 0&F߼H߿߱X߲P߳@'$FX$AW$ $'9 -ߤ(@0%$$ $ $c8%0&,!IJA8 $CGlh)J@l`@%&E$$r*P%2*` %'p l%@폙$ߤp'9ߦ .tߧ@5ߡ ߣ`0$ J߫`$ %` %ߥ('t @tp j!ߪj!a߫%krX*`&  !$-&@@%-`Џt %ߦ $f0%@ ߫$ J֏4`p' d߫؏' ߦ@ ߣ$A,`0%' d߫؏' ߦ0%@߫$ J 4`p' d߫` %ߥ('t @tp#!ߣ#!(` %'x lp@x PKP!߫ PKP!H 3߰$Aߣ$ j $B@(ߤ(!( !`$J <@$ K@0A ߼H߰8߿߱X%߲P߳@'ߣߪ%Jq!jߥ̠ߦ0` % X$@r@%$'9 -@ %A $fߡ0p$ @ %(%p  0%$߲p'9 /(@ % UDߣJJ$CC @(@$@0@,p!H@4@@!!A8 00!ߪ00!O߫ -k`$AIt` %t@%$dh& $b߼H߰8߿߱X$߲P߳@' 00!ߪ00!Vt` %@%t 0%$e $e 3ďl߼H߰8߿߱X$߲P߳@'$ $߫ȍe%k[l߼H߰8߿߱X$߲P߳@'ߡߨ$#  P%p 00!ߪ00!ߦ0` % X$%@t$߼H߰8߿߱X$߲P߳@''9 -@ %$AU@%''߼H@߰8߱X߲P߿0cC b߳@'%ߦ0` % X$%@$߼H߰8߿߱X$߲P߳@'ߦ0` % X$%@@%߼H߰8߿߱X$߲P߳@'t` %t@%$dH& $b߼H߰8߿߱X$߲P߳@'t` %8%% $eh 3ďl߼H߰8߿߱X$߲P߳@'` %'` % @`߼H߰8߿߱X$߲P߳@''9 -@ %*A` @ %$C'߱`$'9 .H iP*jH g* a8 $AC *`X*P% %@0%X*`@% % (% *`X dX! XKP!J@wG* n"!!!p1@%H%'9 -@ %A "@%߼H߰8߱X߲P߿b߳@'@%4'X(%& ` %@Џ4߼H߰8߿߱X$߲P߳@'$'9`` %&'ߥ0 0&F߼H߰8߿߱X߲P߳@'ߦ0` % X$%@$߼H߰8߿߱X$߲P߳@'$B@(ߤ(!( !`{$JE t` %t@%$f0 $e 3ďl߼H߰8߿߱X$߲P߳@'@'!!!1*@  @ @!@ߪ@! @#@@!@ߪ@!  @#P*@H'H! H"H!)1H#ߪ $t8!0!d $cH ߼H@$J`$J$B@ $ߤ ! @`$J 3ďl$AQ߫ߣ`$ JL߫0%t8%@%d $e߼H߰8߿߱X%߲P߳@'l 3ďl߼H߰8߿߱X$߲P߳@''9 -@ %A  @%$'9 .H % *'8 dF* A0 ߼H 3ďl߼H߰8߿߱X$߲P߳@'t` %t@%$f $e 3ďl߼H߰8߿߱X$߲P߳@'@`0J-kKP&@<8B@$@0CT`~߼H$(%4F@ ̸$`u߼H'` % 4 %` % % 4, t' $c'` %0%  % ( $ Ot G+H! HC 0 @!@C ,' ? 78!$c8C0! 0C` %'0%  %$'9' 44` %'t8% % $d3߼H 3ďl߼H߰8߿߱X$߲P߳@'t` %t@%$f $e 3ďl߼H߰8߿߱X$߲P߳@'g X iX! XKP!J`H%H! H"H!) 1H#h'` %% l%@` %߼H߰8߿߱X$߲P߳@'$(%4F@ ̸$`߼HH%@%t8%0%d $cH߼H߰8߿߱X%߲P߳@'@$J`$J$B@ $ߤ ! @`q$J 3ďl߼H߰8߿߱X$߲P߳@'` %(%'\ &@$߼H߰8߿߱X$߲P߳@'8%0%' d߼H'l` %X%t''%%Je ) 3ďl߼H߰8߿߱X$߲P߳@' %  0%(%%ߦ0` % X$%@L$߼H߰8߿߱X$߲P߳@''ߦ% @"d߫%kߡrX*$!`ߤ̀ ߪJ J$ -K,K`}ߥ` %'d l@ӏdߨ@ٍ  %'ߦ %@ߤd%h% l` %@` %߼H߰8߿߱X$߲P߳@''9 -@ %P "ߡ! %@ߣ'ߣ`%ߪBP*@߫"!aX*`%$` %ߪBP*@ ߫"!aX*`%$@` % % 4,َ߼H'% l%@ߤh߼H߰8߿߱X$߲P߳@'H%@%t8%0%d $cH߼H߰8߿߱X%߲P߳@'t` %t@%$dx& $d߼H߰8߿߱X$߲P߳@''9 - %D@%@0! %x$&1` %(% @% % ' %@0!  %߱x$'9 .H %!)X # )X*'HP*+H g*@a8 $H#X b*` 0% %$P!J BP*@$X*`$\$* &$' dt߼H߼H߰8߿߱X$߲P߳@'` %t(%8% $d߼H߰8߿߱X$߲P߳@' z(#\ %* 8% %$B!c e*`$P*@$Bˏtt` %ߥ@%$e $d߼H߰8߿߱X$߲P߳@'' % l%@Qߤh߼H߰8߿߱X$߲P߳@'t` %t@%$dx& $b߼H߰8߿߱X$߲P߳@'pd00!ߧt00!$e ߼H߰8߿߱X%߲P߳@'$$' d߼H߰8߿߱X%߲P߳@'@<'0$B@ "!߼' $4@ ̸$`߿'Ќ <$B%% "!$'9 /( % U߿߼߰'0  %񏙀$@'@!@x@!%%#% 8%2%*6:b0%P $9!P (%H%@U)B@% " 8 @$@ ,/,%'P,$P@E!@@%, (%H%!!@%P"!!o,!!di@%gPx,b!!,B!"!@$P!!y፡,``% %H%p% 8%X%@x%P%@%@x%0%(%`%߫͠@(!!!c!!!!C!"!!!!ߦ 8% %(%N߶*!0!P%߶ P@ %ABH %I X% P%E!$0%+AI %H"!`!E$ + %"!`!!DA + $"!`a!Э P%H%  #!C ߱%߷߾'ph% X% @%`%p%@% 0%`%߫@H%(%ߨ`%ߦ %@H%` %@% 8%`h%@X%x%(%X%0%ߨ p%tߩP%`H%߶W!߾*C߷ ߱'p@%'ߩ*#''`>H!0(8߱%Xp%x%H`%P% %8č%X+%H+Ș+͠%+@++9@ 3$`0%c  @ 8% (% @%+%KF`(+%$ % %B t# !q !!Q!e 2+ `hh * +%me(+@%?$Y@ 0%P0 @ % A# Q!1!Q!7 0+U XA*+%(+%($h %e `%# 4# T1!1!Q!0 H+Y x*%``%%߶(%0%߷0 %߱8@%P%h%߿ +ߡXp+(ߥPp+ 8%p$ߣHx%N8  +Hx hP (BK( D $  ! c#!x!X! U 8#߰x!8!ߴsX!8 ߲h8 #ߵ(!'!߳g! b ߤߣd*`P%`%'ߨx*!'' (@!̀́%%*%4  %p% %8%`8%%@%@%% + +̰+0%+@++͠%$`*s a%!9P%(% ++3 U a$@ %f3* m#?!%!V 4 (!`%%ĺ)%̀+m ++- P $@%y-*x #?!%!r 3  (!%%F(%ob+  ++4 W $@%~4* #?!%?!8 m  (!%% Y*3%+`%% x%@p%߲h%ߴ%߿`%X%@%`%ߵ؍8!sp ߣ0 + P#ߡ@QP!s d $P P 8%d8 8#0!8!(B8 ߦ8 c +0 *H! + 38 D $g  !#߰0!'!߳g! b ߱߶%߷߾'p߱%߷߾'po`P%8%0%%߿ %߶( `% %߷0`%H% %߱8`h% %߿ %`H%%߶(@`%%߷0 %߱8(%NP%ߦ*!@ % t0!BH 8%%IX% P%E!$0%L+AI %H"!`G!E# + %"!`G!!A + $"!`Ga!ѭ P%H% #!C #v'2!% P%ߨ' XC.@!'H%' %!>&$ # B!# "*%+! c % % ! @!%)A %%` (%)c`%80̡$(P (h` %&@`%($p$R@% 8%% %V & x%ax CW!#5 A*oH#+ H%x%H x H* % H+P% P JG&$_(%X% `%x% $X!x ߥ( !X %j! 'i *X@%U@ % G & (%D( # a*#+`%@% A@  *% +`(%D( &'(@%@@% %@% #X!A@ ߢ(!X @%j! $d *% % & %a Ca#u *#+ %%  !*%+ %c 1&$(%%A %% ^ #! ߡ(@4 %q! $Rp 1j%@%h%@%x%`@%߶(߷0`% %߱8%0%߾@H% X%ߡh&u@ `%` ߪp@p%x#u  `#*` +`*xp `+P J ߦ`H`% % `'@xX lx n^& 8%B !# &8 '8#"8 ߢp(*@ %(+!* +Q B.p!8p P!P 8%8 Q0 q e D!E B"!1 ߱H@%>߮`%sp! P# #i *A` %_   P%߶(%`@%߷0 h%߱8X%0%߾@%@X%`%h%߷0%%߾@@%%`H%%߶( x%x߱8P%`H%߲߰߱߳ߴߵ߿߶%߷߾'p %% x%@p%% %` %X%%%߲`H%8%ߵ@% %ߴ`%%߿@%%`% x%@p%@%߲%ߵ%`P%ߴ%%߿@h%0% 8%,@0!$Pf0!F0!&0!%D !yA  "!A %+ %++)k c$  %! Bߪ%# !*!JP! +P  +++($0%0 % X%B $X k%F0#0!J!A0 jP!P 魊 H%%'`& &X% % X k kX# #aX  KP* P+%D*  + %c `% ` x%'(x X%( X #!`* dH!bH  %D !xA "!ɭA $ _ŒlX!4 XC+H!$C#(Œ!Cx!( lX# ,x!p%*h%1I 1B p# 0x!*$  oh#C$!1B@ 1I1C1A `M!CAh -H!.!C)p n!N!m!@'($  <  %%Jz$*!d$@ @%@<@@@K@' <@ % $'9 .H %$'9$ %8 (0%$@%'9 %$ (0% č8!!2G !D @1k`0D@$%- '9 #G#&`* "(( $%('9&@ %" 8* "(( "$ # Jj!# !"!!$ @`DLD< % p߲8߿@߼(߰ ߱'`@p m(%  @@%R@ꏡ LH% PBLP! P)*H!)h%@-"!h!JLP! @' @!@8!8# F 0!($(!( ! ## $i!'9'' '"$'@ %M! 'D , @1 08e <F@bD)@8% Vd @%` J1J@ T܎DR߼(߰ ߱'`  (% UDR߼(߰ ߱'` UR߱0 %@(%   0%*K`߲8*! ߲8D % p<߿@߼(߰ ߱'`$@(%$`4B ̸@D'`$h%`%HS%%*C (B@9ߥP'@0%X8%@SHCߡ2NrX! X @% aX!$$% % >P%)#`}0%@A%b@%$0a$a a4aߥ߿ ߰'@(P@A('%'( QP<($!-% !!#(b'$##$$ ߼' %߱ ߰('P0 >h(%߿0߼%߰(߱ 'Pl %' ''0 'd %' '(0#0# ,##$߿0'(<L$!,%%1!! 1 Q4%'X$Tq  %&$Վ% %$<'$$c##!#$߼'@G H%@%ߤ$$ $ g ߤߨ  8% D0% @ gߤ߿ '90 ?LD߿ $ %<'H`%$#$!#F H%@%$$ $ g ߥߤ8%$ gߤ߿ ߼'@'(%   %$ p %@߿$ p %@$ ߿@@%߲ߧ "߱(D߰g߲'P$'9Pߤ >߰߿'pp%$ k\$  h g `@ D0,$h'8%e 0% a ߿`߳p'e ߤhD8%@0% ߿`<'$! !!p tD%tt $p߿%߼' ߼' ߼' <'$! `!!%p0@0 ߼߰'0`F JA$ E@%$0% ߿ߣ߼߰'0X%<'0!`%`$B $"!pBK $ JCkh$ h\$hd E$8%'0% ߿h߼`'߼`'(<'$B m"! 0%( 4'pH@L8%'` `%''  %)',  % H'@-''` `%''  %',  % ' ' %)'@'''  %׎''  %׎ ''  %㏙''  %׎߱8ߴ@߳Hߤ߰(' T߲ ߿0%߼'p'  %'  %D0'x  @߿0$'@%p@%$8% @ p %߿' <'$!@!!ptD tt $q߿%߼' ߼' '( <8$B0 "!߼8'`ߤ0@ ߦ 'H%@%ߤ0$$$ gߥ(Mߤ08%$ gߤߤ((`$T ߤ0 ߿@߼8'`ߤ0'' ߤ0 XD@ ߧ(ߦ((%$%@$%@ۏ@'ߤ0'' '   @(%֯tt $q(ߥ($' %$ .(<x$c%p%% #!( V*i Jh$ $a`R߿h$b$c$f$ i $p$s$ u@% ߰$ߦ`'@ ߰@$ait@ %t@%$r& $qH߼p߿߱x$߲߳'tt@ %H%t%r$r& $r߼p߿߱x$߲߳'t@ %t@%$qh& $qH߼p߿߱x$߲߳'ߨ`-$' ߦ`$a@߿ߦh%@ % X$߰@!߿߼p߱x$߲߳'ߩ`-) $b$' ߦ`@߿ߦh%@ % X$߰@߿߼p߱x$߲߳'ߦh@ % X$%@%@߿߼p߱x$߲߳'$' ߦ`@k߿ߦh%@ % X$߰@߿߼p߱x$߲߳'t$ߦ` $q@V߿&$ . ߰t@ %t@%$q $q߼p߿߱x$߲߳'$' ߦ`@<߿*hr߰&i % H1H!P$' ߦ`@-߿$c߰t@ %t@%$r& $qH߼p߿߱x$߲߳'t$ߦ` $rP@߿*h߰ߦh@ % X$%@߿߼p߱x$߲߳'$'8 ߦ`@$ u$ i߰t@ %t@%$r& $qH߼p߿߱x$߲߳'$'9 E %@%@߿A  %(%  0%DE eM$'9 G@ % UD߿߼p߱x%߲߳'$@ %'9#P@(%&' H&f߼p߿߱x߲߳'  $'9 GߤHߤH U&1ߨP(  %@ % X$ߦh@@%$'9 E` %@A H` %(%  0%ߥH eُ$ԏ߿  $$'9 E@ %$@ %a;߿''߼p0߱x߳0c  B߲'%ߦh@ % X$%@6߿߼p߱x$߲߳'ߦh@ % X$%@߿߼p߱x$߲߳'t@ %t@%$r`& $qH߼p߿߱x$߲߳''0@% @ %@߿߼p߱x$߲߳'$'9 E@ %A X'@ % 4`%ߥX@ %`% 4,@ %' 4`%ߤX x@(%@ % 4`%ߨXt'@ %0''$r1 %(0 @%ߤX00$$ $ ߪXKL Ot G+H! @! HCK$@CJ ' ? 78!$r(8C0! 0CߧX|@ %'0'% 8 %8!@%  ߿$'9 E@ %E@ %% 8+$'9 E@ %Q  ߿%@ %`% 4,1 ߿$'9#P@ %&'ߥh H&f߼p߿߱x߲߳'tt $qߤߢE%@$@ %'9@(%&( ߦ8 E&g߼p߿߱x߲߳'$'9 E@ %FX$@ %'9@(%&( E&g߼p߿߱x߲߳'$'9 E@ %E  $$(%$@ %'9@0%&( E&g߼p߿߱x߲߳'0ߦ@ Q0ߨ@,$ 0$0$ߦ@00U ߼pߧ@$4(%0 ̸$t߿t@ %t@%$q& $q߼p߿߱x$߲߳'%t@ %t@%$q& $q߼p߿߱x$߲߳'@ %'0%  %ߪX@ %'0%  %ߪX@ %' 0%  %ߪXߩ@4 7(0t@ %t@%$q& $q߼p߿߱x$߲߳'@ %'(0%  %ߪX0<'0$B  "!߼' $40 ̸$߿'Ќ <$B %% "!$'9 G % U߿߼߰'0  %񏙀$'@@H%< $ $ 0$$!C$ A0,h`px@',h % hĎ  ! %%%(% 30%$$ (8!`!CP! ,!J!'!q!`*Q!,0 $ (CJl!8! 2!LP!J!q!!C!*A( ߶Ҁ*P0 j*߲`!( ߱xE߰pb߲`F߱x00c `]0PaDP%%% %w@X%$#8 #$Gߵ8E( 00i!x! o!$'9P % ET(%0( S!x!#!h*- ߡX߮P$ &7X! $3!"X `!b X00/!@%`08%@g#%H#t@! %, %Jr( 2(!q##@Ž( $0%0!`! !$'9 % Eߥ80( $U!`!߮8p#ߡP*H!p 8߫X# .p!5!'p G x!Ptt $s( F#ߣ0K#&# Ï@8> <C@QD2(% 8%ߦ0 Vd@@%@߲`c0c` T܎  1@.`(%0% @%ߧ0  @H%@߲`O߲`߱x߳ߵ߶,D߰p߷ % p߾߿h߼Hߴ@'q* rH#o%2*@qo %߼Hߴ@'  `(% Uӏq#(!C!.!C0!k!#H!'!CCN!0#k!#P#'! Cj!#Cn!|0k!!#R#h!'!CCC#0n#!2#q#H!C!"#C0a!!2#H!!CC"#0U!#!CC!!CN!J0!C(!!C.!A0#!!CC.!08! Uf  ` %$0(%$4 ̸0bP%$ @% 00!(#A@ ( B8!"!% 8!+#(0*P J *D (C P%$ @%$  00!(#A@ ($B8!"!%+8!,#(0*P J *D (C t' 7%$B, Y0@ %(% '@%@0%`߿ ߰" ߱'@ $4$Hߨ$@ @$@@@@ @@PH@%@0< %@,$ 8!G(@8% ܭ ߿ ߰ %߱'@菄$$  t 3$,$B,'@0P8H @(%ph%%X%PH@80 Π(A p@ %`(% X$@@%$ %C0c`{tB )1) tt,q$'9 E %T@%@ %'' %@$ $ 0$ i$4c0 ?'`$ !x $ t @%$ b $l$r$ e $ f $6$p$ f. %@L'ߤx 0%@FWP*@ ߦ`(!@ % 茥@Fߩ&s&%)ߪ%JAP*&s@&ߣXQ&@ ߡXT$E %폙$'9 G %ߡX 7 7 t@ %tH%,$s $sx߰0߱P߲p߳8ߴhߵ(߿@߶$߷H߾ 'tt@ %H%t%tx$tPߦx $r ߵ(߶߾ ߰0߳8߿@߷H߱P$ߴh߲p'ߩX*>| %0%  $  ߢH%$B@0X߶ߵ(߾ ߰0߳8,߿@߷H$ @ ߱PJ߶ߵ(߾ ߰0߳8߿@߷H߱P00A ׏%߲pߴh'`hf$t@ %t8%$t( $t'Hߤx 0%@D$ bj'Pߤx 0%@=$l$ `'Xߤx 0%@5$r$ V'`ߤx 0%@-$ e$L'hߤx 0%@%$ f04cA0Dߤx 'p@$05)70Dߤx 'x@~$ V$pDߤx '@ $p04!%0Dߤx '@H$p$ fDߤx '@$ f7H* y4@ % (%0!' @{$@a$ߪ&s&%J  $t@ %@%t`0%$sX $s@߰0߱P߲p߳8ߴhߵ(߿@߶$߷H߾ '߰0߱P߲p߳8ߴhߵ(߿@߶$߷H߾ '7H* :4@ % (%0!' @$@#t ߩ&s&%)߰0߱P߲p߳8ߴhߵ(߿@߶$߷H߾ '05J0$(%4F0 ̸$#߿@t@ %@%t$s0!$s ݏt@ %t@%$sߦx $sҏ $%' &%$ '%D ߿%@tt $tDF߲'00 $,$߱߰'0߰߱'0# $ (%4&0 ̸$߿<'$!P!! ߿߼' $'Ќ$<$B%"!8$$e   ߰ U$1 ߿߼߰߱'0 @00`d4H($@!$00! (04B0 ̸߿`@$  (%$  0% U$&  %$,, ߱ 4@ %00$(% $H$ % Ӹ$ ߿߰߼ 00 $(%40 ̸$߿'9 G %߿0$(% ̸$߿'(%% %@(%$.̠!$'0%$T̠0%PHx`ph %8%X.P%@xph0F#&D*$ @%H'$a$a$i$h$h$iP$b$i&W$hx$~$cXߤ(ߥ0ߦ X$@߰xH1$$'9 EߤA@%J0$$CP$ !J0ߨ߱&߳@83!߳ &$r %(% %@$w@*&1SH*&s - % %,A@%$a -%5$e=$ f D$iK$pb$s %'0% %$ t@wD& d %i$l$r %ߥ %@$ʮ %' 0%@ߡ$aԎ- %ߥ 0%@̎- %' 0%@ߨ$ e Ď- %' 0%@U$f- %' 0%@]$i-D % ߥ@ߣ$i-D % '@$ i -D % '@u$p-D % '@H$p-D % '@-ߥ %@& %ߥ %@$&-tttP%0%t%)v %u$uߤ( $u߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@ߡߩ ߣߦ,$ߦ00 `ߩ@ߨ @!ߩ0ߡ%)$! 0߰x߱p߲߳hߴPߵX߿߶%߷H߾`'@&tt@%$uߤ( $up߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@t@%t0%$uߤ( $u߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@ $$ IH$׮0 鏔Dߤ(% X$ߦ@$'9 E@ %F%$ՏDߤ(% X$ߦ@ُ$'9 E@ %F% A`Dߤ(% X$ߦ@я$'9 E@ %A  ߦ$$ ߬ߪJ ߣߨL0%0! 0 Flt ߡ$ %$'9 G %Dߡߨߣ    |z %ߣhv|0%ߤ  $ @%+,tߦ0$qHH%ߤ($@ $0߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@쏔Dߤ(' %@߰x0$AP$0D5CB0D$ߥ %@0$  @$60D4ߤ(ߥ' &@j$Ə!!(%$ߥ %@0$  @$50$ߥ %@*0$#$4! 0߱p߲߳hߴPߵX߿߶$߷H߾`'@ttߦ0ߤ(@%$t $t߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@$ߥ %@t05ݮ0  N$ߥ$4$ ̸0ߩ@ߦF$F$ $0%$ߤ'9 E A  ߦ߬߬D4ߤ(ߥ' &@c$<@!D ߤ(% ߦ8@w@*߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@D4ߤ(ߥ' &@H!| tߦ0ߤ(@%$v0 $sx߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@ hߤ(t$qH@%ߤ($& $߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@߱p߲߳hߴPߵX߿߶$߷H߾`'@$0%t$qH@%ߤ($H& $8߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@tߤ(@%$uP& $u8߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@D4ߤ(ߥ' &@-$@!$߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@߰x߱p߲߳hߴPߵX߿߶$߷H߾`'@ $0%'PX@(<8$BH%P%%0 "!0 ^$p+h$`(x$t'`%W!ߵh߰ߴp߳x߲ߥ0 %߸(' R8 @߿X߼P߶H$߷8߾@' $$$ߥ EV@%@8%I %%[$6 𨌥,p $ x|t$  lHD@<80,$  4($ 4 % ^8 $ ]d,lP % cT@Z' Xԏ|0% X $ߤ 8%< \ 4$ %(%'9M@%& St'@>߿XߢB@}ߤ@z@%R'  ߣ(,H (&y߱` %  %(I @%!5 % %@0% % '@*c`ݏDt %t@%${H ${(߼P߿X߶H$߷8߾@' S߼P߰߿X߶H$߷8߾@''$$'9P'$, % T0ߡ ' %鏙0% [Ԍ,$@%'9f %@(% Y'ȏ$$''9P$' T0 %ߡ  %ߡ߿Xߤ %E,%W \t8%%߿X߼P߰߷8߾@,%߶H''`h80@<`($B@XP%%H N"!@x ߤH$p $ a @% $c$d$ e HX%`t@0%$ $|@`$ e BH% t@0%$ $|@@e$i$$ p M$tn$u$ y@% 3߰xttt` %P%t%)}&%}$}߲p $}pD pߤH߿h߱X߳`$߼P't` %t@%${`& ${(߿h߼P$߱X߳`'.H$ .J@H%$ t$@0%߰x $}H@߲pߨ@$  t` %t@%$}X& ${(ǏDߨ@$ ߲p I߰xt` %t@%$| & ${(Dߨ@)߲p߰xt` %t@%$|P& ${(Dt@0%$ ${x@i$ a.Hfߪ@$߲pA߰xt` %t@%${& ${(D'Ў$ @0%@R$c.HNߪ@)J߲p@s߰xt` %t@%${& ${(tD'؎$ @0%@$c9$d'$ @0%@$ c 0$dt@0%$ ${@($d.H$ߪ@$߲pA߰xߣ@$h$` %ߦ@'9M$&'ߥH St$F8'$ @0%@$ eߡ@$ ߲p):߰xߣ@$h6t` %t@%${& ${(+D ` %ߥH'8% V&@! "D߰H @!  %ߡ@$$#"ߪ@$A$` %ߧ@'9UߥH4I&(  Uh$8D p %߰xD pߤH߿hߢ8߼P߱X߳`''$ @0%@$i$ p'$ @0%@$i$ p'$ @0%@$ p.Hߪ@$߲pA߰xt` %t@%$|& ${(ˏD'$ @0%@$p$tt@0%$ $|@$t.Hߪ@$߲pA߰xt` %t@%$|& ${(D' $ @0%@$uߨ@$ ߲p ߰xt` %t@%$|& ${(D'@$ @0%@x$ yߨ@$ ߲p ߰xt` %t@%$}8& ${(zD ` %ߥH' 8% V&@p qD߰H@!  %( ߥH` %8% $  IHD8 p %W߰x.Hߪ@$߲pA߰xt` %t@%${& ${(DD$'9lߥH` % [&=8.A Jߣ@$߲ph߰xt` %t@%$|& ${(*D$ 2d$pߨ@߲p ߰xt` %t@%$|& ${(D( ߥH` %@H%8% x 8$` %ߧ@'9_0%&(ߥH W$@DD '8%&ߥH V` %@ߡ@$#. 3` %ߥH@H%@%8% x8 ` %ߥH'(8% V&@܏(ߢHBC!BB@$C$H$ J$A$C̏D'8Ȯh` %ߥH'8% V& P+0ߡ0 ߣHcl`@*0% $ߤH Uh` %ߥH b0%8D$'9wߤH ]ďD ` %ߥH'8% V&@ߡH!%DߢHBC!BC$h@cHh$ Y`ߤH{8(ߥH` %H%8% 䌥p8 ` %ߥH'8% V&@e,'bh.J@ߡ@(!߲p S߰xߣ@(c`Oߨ@$  & $'9fߤH Y%L8.A bߣ@(c߲p`-߰xt` %t@%$|& ${(9D' d6D'% l` %@-D` %' l% @%ߨH$  O ` % fhߥH8'(j$ߧ@'9_` %ߥH&( & W$@ D D$Rt` %t@%${Ȏ& ${(Dt%}ht%J}jt$!}(a'0c ` %ߥH'$8% V&@䏢$@ߦH@0!$  h` %ߥH b0%80%d` % btߥH8h` % bߥH8(ߥH` %H%8% x8 ` %ߥH'8% V&@` % QdߥH8` %ߥHH%@%8% x8<'%$!p!!#%P@!cg@  %$$C"$GH78 D` ߤ@%D p %߿߼߰ %߱'00! (d8ߤ$ |l,Q 4't'$~(  %ߥ،' % ,ߤ @% 8'ߤh$ |d,Q8ߤ$ |h,Q' p% cd,@R ]@9(8$'0&sPA!H!)$'$@ %"d`% T0%GTp(%ll$l A!H!)@ %(%0%8% T0`%ߵ(ߴ0߳8߲  %9 % 0A!H!)@/t0 ($%&K0(% !& ŘVߵ(ߴ0߱ < ^P %8%(% H % Ӹ$߰߿'PӬt $~80'<$BЀ0%4 "!߼߱'0#q &' '߿$($%'  c(%@@8%߲$'9G0 Q %߿߼߱'0 %& S&'% %,  0% %0%߰' ߰' ߰'  % ]߿'<$B%$S"!#$fW$$ 􏙆 ߿ $( %߿ %d h$ @%$a  ܘ$d߿ $A*( @ %8!e!cd$$*@$$ ( t ch %@ ^ % (%($ 8 %@ @%߼߿ ߲߰߱'@h0% (% bЎ߿ '9J R %߿ @ @%Ԯ<'$!!!D ^%0"( %@߿x%H$ !%& _l$% !& cl%(*T$ߵ ߰(߿߶0߼߱ߴ'P'` @`'X$#h$"P$!H%%P%$8_% $0(&1P %`8%@%H% pP%@߫߰h߱8߲@߳`ߴXߵH߿߶$߷ ߾P'k$ahDl$ D$BBC$'9[ %(% V$@ID ^ %D  ߥ@;D  ߥ0@S% % !0%(% %&&8 T04 X*U`L `T %߰h߱8߲@߳`ߴXߵH߿߶%߷ ߾P'$"ŏDH$ Ӹ$K0D$ ǎ߰h߱8߲@߳`ߴXߵH߿߶$߷ ߾P'ߤߥ( @ Dߡ$ + (%ߤߥ0 $ ߬X ' (0d8$$ @@%^h\h%ߨ(ߧ  $ jP߫H%H$ pKP%@߿H$߰@߱8'p H  ߿H,0H %0߿H$# HHߥ0 _l %@M߿H$߰@߱8'pd@H% H ]<$J($ K $Dd`% @߿H$'9J R %߿H dh@%$$a@(%H$ ܘ$d߿HHDߤ @(%@ŏHd$@(% ]d$FX@%(%HPx cl %@߿H$߰@߱8'p$$ @$ > `%$ @%@߿H$߰@߱8'p%  ߿Hߢ$ X%$ @%@߿H$߰@߱8'p( L߬ % `T (߿H%߰@߱8'pbP{d .' h@:$d$ x$ $aX$@ $ j;ߦ$ȏ8d$ |$`$@%d$a$ X$d߿HD@ % h@񏙍` 5J   $Ȏ''@ %d8 $ ( ŏ @%@ $ߦ@ %h$ ( $Ǝl'Ph !p%`%h%$x`%%P. %($8@(%0'9P`0% 8%@ T0 %$@߿߰h߱`$߲x߳p'#w߫PXߪX@xd8iX%ߡ(!!'$j$c Q ߫X߰ߡ0!`d (ߤ( ]@@0%$'9n [$ %'9P@(%`0% T0 8%@ ߣ8߰h߿߱`$߲x߳p'ߡX #ߡ` ߦ@ߤ(ߥ [Ԍ,$Hߤ@'9fߦ @(% Y$ߡH'߿'9P$ % 8% T0 ߤHߡ! ߰h߿߱`%߲x߳p'(08@dxP(ߤ( ]@ dK$Xߡ(' 8$a<$B0%(%%Ab"!$lCh$ eIo$nAv$@B}c Hi!c0c`@ % (% l'@ߡ߿߰0H*߱8 ?߼($( ߲ ߢ'pE%t@ %(% 0%߿`(%H !p x (%@ ߼(߰0߱8߿ߪ%߲ 'pE$* 揙@ %@%t'` 0% $~x߼(߿߰0$߱8߲ 'p$()( D'H  %@>߿*D % 'P@!߿*D % 'X@߿*D % '@-߿*$'9l@ %(% 0% [4ߧ@߿x*߼(ߢ߰0߱8,B"#ߢ߲ 'pA%߼(߰0%߱8߲ 'p߼(߰0߱8ߤ%߲ 'p߼(߰0߱8ߪ%߲ 'p$ I<'8%$!!!߼'  % S߿'%%%  $0`@%%@%2d`%T0! ( a8!$c$!g @%$H` %(@%$0%$b$Í(!!%!!#!!"!! %%$$$b$H)!!%!!#!!"!! %$$$bԌ́(P!J8! `! bX!k `%``*  $HMX*@%H`I! IP!J*H $cm8*$!%)%(  % % $ Hp!@0@,@(@$@ @@$ M@ @PU8@S@@l@h@@d@`@T@P@H$ M4@L@D@@@<@%@8@ % ^DL|@ % cߴ0ߵ@߿@ %  %߰߱(߿߲ %߳ߵ'` @%߳߰߱(@%߲ '`%% `!, $JjX!k+ %JjX!k+%J8!}' '@h%x% p (%'`ߤh V$ߦp@j߿`$߲߱'"@e!l @n$ D` $c@%nX{t%v@$ r $sP%A7߰D%ߦX`%` ߰@/$)'ߪx$#$!  %J@8H$ߤ '9[Џ Vߦ@%@%@?P$'9P %&FߥH T08%$@{ߤ $ߡ#ߩP ߿`߰%߲߱'ttH%tߤh%~$~F $~߿`$߲߱'C!lt@%'``ߤh $~߿`$߲߱'`߿`߰$߲߱'@0%'D $H$c@ߩX-) $ tD$v@ߦX $؏t$c@|%v@ߩX-) x$ D'ߦX $@t@m%v@ߩX-) j$ rvtD$v@ߦX $菈t@^%v@$ hH$ߤP Ӹ$K0߿`߰$߲߱')d |ߧPy@vFߥ ( [Ԍ,$0'9f@%ߤ(@(%@0% Yߦ8(ߤ (% ]@ߤP$ߨ0ߧ@'9P'$ T08% ߤ0Oߤ tt $ߤPP%'1@<$B% "!11$0$`@.x cl %Tߤ `(%߿%߼߰'P$@ %$ xdDh' B $߿@1$x cl %Tߤ `(%߿%߼߰'P`@ %$@%$ad X$dˏx %߼߰'P%߼߰'P5ܮ'<$!%0,!!D(!HC @%!0(!T ` %߿ߢ@ߦT0D(!c % `߿%߼߰'0ߢ<'$!!!ߤ @߿߼'0P `lߤ߿%߼'0'`X%`%U%hP@ %x (%t@%$$pp 1h%@0% (% `%$% 1h,@0% (% `%$ߤP 1h%@0% (% `%@S$GO@ %$ 1h%@0% (% `%@( %% ( (% !$!@% C!`G߳p$ߴxD p %߿h߰X %߱@߲`'hP @ %@0%@ %@8%'H $@@ %'ߦH $P@@ %'ߦH $@t0% $8߿h$߰X߲`'$%' 1h$@0% (% `%@ % @%`߳p( ]ߥP@@%bG߳p@% ߳pDCDt$D,'$E % D@H0 hߴx?%%$'$$(8@0% % [Ԍ,$'9f@%@(%ߤ8 Y0%ߤ0ߥ($$'9P' !$ T0 ` %D* &1Q!BCt&REd( ]@@%b@ߥ0߳pߴxP%D$% 1h@(% @0%D t'3% 'ߥ  0% DD 8(%DE@ % ,@&1'8*폙 ߨ D$% 1h,ߥ '$8%ߴx&& ߤ 8(%'$ Dߨ $ߴxr ߤ n' P%%% `l %  % (%0%8% V''h@ ߾߿$߰ ߱'P&80!' |߿߰ %߱߾'P'8 PH@% `l %dߤ8'0%$ 0ߨ0$, 9@X%I!A(ߣ %`1߿@ ! 0%$$P%t'@*P%|bH* p'!!* xb!c*`$ %P%ߩL*߱$:%P@ (߰H'ptߤ (%0% ߱߿@$߰H'pd@%'0%%X(  %@X%ߢ("&,!'%%%( $%$ &n [%&*  !&1U&&*&*ߵ(߰ ߶ S߱߿ߴ'@'08< $!!!%%%@ %Q!$.&B('+$V 4 $' <,&%$# %o %f %D$BdE(HP@%%$' 4'؏$ߥ <'$'p <'؏$ <' &珙6Q !`(%0% % % (% '@, %  (%@&  %߲(߳0߶8߾@ߴH$D ߵP@%@ %  (%' 8 %' 8 %߼ ߿%߰߱߷'' &E ď(HP%'(@<H$!08!!0%0%% ^$%`\(߳ #`$XP@ % ]d (%U4@%@ %0% [Ԏ,$@%@(% %'9f@8%' Y$(@ % ]`(%@@%b@P$'b'ȯ'x'9M$'e$ StߥߵP % c߳ ߤ  %(% cߵP $PCߴX@ %(% c 0%߼H߿0߰@߱8߲('@ %X ]`(%@%@2@%b@D$ U0$'9n [d%߳0߳%`` %cp߳@ % c(%ߴXl߳jߴXI , ] %`ߴX<'$!`!! 4L%  %߿߼߾'0<' $!!!0% 0'@%@߿߼ %߰'@ $4@ %@% 3(%$ߤ'ߧ $t߿<' $!p!!  ]<%Y0@ %`(% '@(%@%߳@ ߿ $߿@@@ߤD  ߼ '@<'$!!! % ]<%Y,@ % (%߷@߿P ߼%߰'0'Ќ<$B`% "!`߼߰'0 4   %߿'`xX%@ P%ph`PH' '0ߴ@$&(&#8H &RK0* L$B"L `T %1 +ߵHߵ@l#l߶ dߧ%8*&##$@(%% !& ӸV$$ߢ88*#* *$֮"ߵ(ߣ0 d ߰PߴX߿`߶h߳p߲x߱߷߾'<'$Bp"!x ߼' kX$x߿dh`\XTLP\X|txp'ЌP<$!%!!  (߿`  (߿L D߿T  (߿X  (߿\  (߿߼߰'0'Ќ<$!%!!  (߿  (߿  (߿  (߿߼߰'0<'Pp$!0$!!xh% Ԍ( k8<$@'0` ((% $`߿0((%% $  R` %߿߼߰'0$؏T % `(%߿ ܎ D߿L `T %T % `(%߿0% c߿<'$B "!0`߼'P(4 ̸$ ߿<' $!0!!0(%$ Y` %P `l % Y %@߿(߼ ߰0'`@5߿(l' ''' D ߬00!1(! lX!(#ߩ0#P*j0 p(8!0 *( ( ( H1x@ %(% 0%߿(%߼ ߰0'`%߼ ߰0'` T@ %'0<$!@8%%(FF!!@T %H `(%'ߤ(8% d@߿H߼8߰@߱0'p )'d&1!d'H '( % (%'9'' c('ߤ(''%d @%@߿H߼8߰@߱0'pT % ` (%߿H߼8%߰@߱0'p߼8%߰@߱0'p$'P%"(c@0l#i#k!$cC|0"!`!% %8%F '߿'@tk!C|x"!`!'<'?!('9 hd߿%߼' $%<'$P#$!Ed(D ]@߿D('9 hd߿%߼' %<'8%$!!! (%߿ ߿߼' T$ $ 4@ (  $ @!x"#@$8x&$dj x00!00#00#D!Gx$jxD!$dA 0#$'X%`%"%$ e, 4 % mf0߿߾'@$Dx%!p%'p %$$ "%C@80( ߤ(ߦ ߨ8ߩ0ԍ0(%P%߭8% ߿@'$@80( ߦ0(%(8% %`H%$8@@%@P% X%߿@'p%h%$x%%"S`%$ k",( ߧ(ߦ X0߹,90`!(%\`#KP! _x!lX!0OP! XC llX!߿0' (0 ! # #$$<$/$?(!(Ce!<$?$e $c $ $$ 0'ߦ(%M&,B bP ߿0'$'Ph%`8%P.G%$!A4@>Ď ŽXl!C@#/(!G@!(C@C(!#!,<,?`!,<,?!(# <?H!`0c(`d0ߥ0LP%$ ߤ($'߰P0% ߤ($ ߥ0$ $$' ߿`߰P' 4$( X080$ X(%$ `0%!# P%#x!߹8p&Œ$xC8!!8!C$@!@8 H% H߭ ߮Xߧ8ߦ0)ߤ( ߿`0B@ߦ ߤ(ߨ@H%ߧHߥ0 P%%$ ߭ ߧ8ߦ0ߤ(߿`q ߥ0ߤ($ ߰P$ $$' ߤ('$p%(%"@h%'P\d!TCk!$$ $ $$' ߿'P'0xh`X X$%p%%0`%J!#&!H&?A  %'$ D' ($0c`|$ xP%`#`H% _0%lX!(% XC rX!߿@!""@@w܎ `&`$ x*H#H G8%$ @!`(%@C  @!߿߰`߱X߲x߳hߴp'Ў@'($ ',($, xH%h#@% gߧ@`0%`!$  `C`! ߿ @08ߧ8߮0܍ߦ@`!`#P% _H%$lX!`(% XCP lrX!ߧ@ߨ8ߩ0ߪH( %߸P'9(%`0% @X% f8߿$ xP%`#`H% _0%lX! (% XC rX!߿ߧHH&T@@%`(% $߿' %(p%h%0@x% "ߤ8 X߹(0(%$,0%Ch&9߫OP!`!*H!`#%/8 WH LP!߬0% PCߧ m<LP!߿8'<'$!`!!d bt߿߼'0!'X% % ߾'@4$'` % m"߿'$Px%<$ X$ g$! ap8,'(%%0@ k%`%<@$$h%$ < @5kߨ`@&-X ?h % (%'9@0%'$ i' ('$' $@8% '9 0%(%p % c X ߭<@$ߪ$@p"!p0$kX!HH*+!pI@ hP!$  ߢx X%NP$3 !!ߩh@&%x'@*ߩx !L '/H$ 8ߨ(%8(x%߮p, % k'<@$$'߭Ў(dP!߫*H* UP*(t|%&V!F(X*`%#`>(H!U!%0!x #|e!cst8%$H`%$0%# !%!$xp#|#!! !$t$eh(%!#!C"axBp#a|%!!D!"t$# !%!sspb!(%%ߴߨpH*i@ p`%%j ߨ$! p% o`(%%ߩx߱$A߰$*!H&(I ߾@*߲ `(%ߪp!p߾!߲p!߱PX* P p߰!#߳ߤx% # !ߵ aX!kjxP#j|!H!)%t@!p(!b@*$!$$c(ߩx$ ߨx!< ߵ*5k@ߩ` !ߨp(@&-!(X h#!aX*`x! %H*) ߫h!P#|cX#bX#t(!߿ߴ߶ߩߨp(**H $d߼X$h߷P'%߼X߷P'%X!kjxP#j|%H!)3t@!p_! <'?% $< %߰߱' $?g!&CT*k!@"(0$ $ $$' (% %$ $<$?8* $ < ?5* 맧駴߿(߶0߰߱ߴߵ ''%= ($Dߤ ,<<@58%0$ߤ0  ߢ#1`E , $DߥȌ@ % ,ߤ 'ߥ߱ ߿(߰'@'8xX`hp<$BwP%"!D$`%"@%8!%$,% %"ߣ`ȏDd% ,@@@߬߿q߷Ȏ@ r6T"@0Ȏ\0Ȏ78߬ ߣ$!@ @,@``%@&L߭8,% % k' ' ( % (%0%ߧ@'9@@%@H%ߪ`X% d$߫߭$ $X!h!߷eh#>߾ %(P (%0%H8%'9@%H% @P% e| (߿HߡP % (%0%8%'9P,@%H%ߪ@ dT@X%"T@.߿߼߰p߲߱X߳`ߴhߵx߶߷' ,l6P"&,!~ %( (%0%8%'9p@%H% @P% h߿6xvXߨ0߿H %( (%0%8%߿P'9H%P%@X% d ߿ %( (%0%8% '9p@%H%@P% e\߾߿' P%`%%`%` %(% D0%߷߿$!߰'PE ̍D8%0% ߷߿E 4 % mF ߷߿߷'@(<$BrP@%% "!߼@߱(߳P'hd88Hp(',0%%%%x k@%4$' md8c$ $X`%p-`LT̏ ('$' 0%'9@(%` %h* cm $Dx* ` %CxCT` l0`!X* !k $DxP|ߡhc߬p!0X*h*%p  h߾pr^!R^L'~88%$  #ߩxY$ AP V7X*߬X`!`~ 0%( !!@%` `(%a$ %#!!$X#!!&\0C!!!B'!(!Ap#!!)t#!"A*$A$ck匡`p% `%`!XknX!kt\lk0`!kX!uX!X!pl`!߫xtl`!mX$a0%%߭x%!!p(X!-!%+h!x߫`C$ kA&l((@ %(%'90%'$ i' AT$Cx ( ('$' 0%'9@(%` %ߧP* cj $Ax#* MߧKCx, % k'w'!(` %@(%0%'98%'$ f|' $DxT $cׯ $c3 $c CDx(` %@(%0%'98%'$ fx' $>Dx`߰߾#X*߬X߷ %߲`!`' ߰߾߷!߲mh!Xl`!\ka0bX!!!k5!?!apmh!߬xtkbX!ka4!am$cmh*$B߼@߱xa(0!!6!߶h!5!4!ߴ`*?6! qd*߱(ՠ th߳P߿ߴ8ߵ0߶H'kcX!kvXa#!!4\mk0h!kX!uX!X!pa#!!߭x-tkcX!ka$ ,$9a'@%<(($Bl 0%% "!dC`,8 %(%8% RF@߿8߼0$߱(߲ 'p@ $((ߥE@H%Q@%@8%J %%ˀ$Ʋ0 𨌥, % h & 3(%&LH 3(%& 3(%& 3(%dX,($ $ $߫<84 0l@ @kD % { DP'0%(%   %0% ' ȮĮxd`$h\'8$ % X$ X'@jihXgfXec<$X %''H xA <''P % xЎ'X Xԏ|0% X $<"(8%4 $p􏆊8%<@ 4$ @%($$ d$Р( %(%ߦ'9ð@%&G p$@ ߿8 S߰@߿8߼0$߱(߲ 'p߼0߰@߲ ,%!߱('p8H 'X,x$ b,\' ,`'( ,d'0 hߨHx %x@%8$煘F $x߿8߼0$߱(߲ 'p'<($Bg%%%% D"!@ @ %$ $b^$cq$d$ g $iߏ $m$s)D5$tN$w[$ x i$y%#-߰xxx %P%x%)%$X& $H$D p@ %߼߱߿߲`%߳ߴ'0x %x@%$& $x߼߱߿߲$߳ߴ'0$ߦ' ߰@Ώxߨ-ɏ@ %(%ߦ  8%@%$'` ߦ@$cߩ$!߰x %x@%$؎& $x$$'h ߦ@$c$d$'p ߦ@$ c $dx$ߦ $p@w$dߨ-rߩ$!߰ߣ$h֏( %@(%ߦ'9ð$&' p$@%$' ߦ@$d[$ g$' ߦ@s$dR$ gx$ߦ $@I$dߨ-Eߩ$!߰x %x@%$& $x_$$' ߦ@2$dߨ$߰ߩ$!x %x@%$& $xF$$' ߦ$d@$i$'P ߦ$d@$iߨ-ߩ)) j߰x %x@%$& $x$$$' ߦ@$i('9@ %(%ߦ 8% yx߰@%$' ߦ@$mx@ %(%ߦ 8% D߰@%$' ߦ@$s8@ %(%ߦ 8% ߰@%$ '@ߡ,! ӏ@ %(%ߦ 8% h߰@%D' $@{ߨ$tD' $@$tߣ,c`$t@ %(%ߦ 8% ߰@%D' $@$w@ %(%ߦ 8% ߰@%$' ߦ@$ xp@ %(%ߦ 8% ߰@%$' ߦ@$y@ %(%ߦ 8% ߰@%ߨ-ߩ$!d߰x %x@%$& $x$ߨ-ߩ)) G߰ߡ$#&쏉p)''x)@ vߡ,! 4ߣ$hK߰x %x@%$& $xd$-('9Ր@ %(%ߦ 8% ud߰X@%p % %@y$O$\'@(%& x %@TߨE$\ %@(%' x&@@ %;$x %x@%$熀& $x0$ %|H%(@8%E $%@%\ %@(%' x&@`$ߨ-mߩ$!߰x %x@%$& $x $ߨ-ߩ$!.߰ߣ$h*x %x@%$熐& $x$$  J\ %@(%' x& $ߨh$"  ߩ ㏙Dd' 'AݏDnTpl!լadcHhߨ$  Q0%('9P@ % sT%@%\ %@(%' x&@4d$'''' '@Dx $Dh' ($' $ | %ߩ |'D\'@(%& x %@\$!C#ߣ(c`DX %$ h$e`& H# @!* A#hH'' |%(#T'H X'$ Q(菨HaD"0! H %p0%(!x $ ߩpߨxݡ(  ߤTߥX %'P'L @L%P(!@ % @0%$' |'ߨL% @*&1 P($ ߣXߩhߡ%)h!H*ߡ`$cX$! `ߦX('9'@ % r ߣߡ`#* ߣXߤX h@(%' |'('L '@L߱' '& |8%ߩL%)!H* &1 %@(%' x&@Wd' '& $<$=I(%$>ci$ !G'Ex`Bx@+M0\ %@(%' x&@@ %$ %|H%(@8%E x$@%$ %H%|@%@8%E x$@%'D'@'<'8'4 '@DD@<8x4 $D,(D0@ x %x@%$H $($$ߩߡߣ`|D0''x)@ u *0@䏇xߣg$ !$ !,I篩0 (Hү0`(Iꯤ0ٯ09)د0<'0$!W!!( |(% & 4'@8@ %E  @%' 4 %@ %߲@ 4Lߤ&L 4'@@D @ @%' 4 %@߱8߱8 4Lߤ,@ @% \ Td|8%(%`\ $ %@ @%߲@߰(߿ ߼0'`'`H`%|Xh%P%`H%%@%8% h$ pP@d߿X$߰`'茁\&XBFx0fh`Č!&ďxx@%$@ߤH $0X߿X$0߰`'Ď Ԏ ` @_$`^, ,(ߤH x@c,X \) X`(&` X4ߤH%' @߿X$߰`' X"@ud!(X X#` $"@$#`$($g$! X %(%0% 8% `$h@ߣP`3P4$$8 ('90 r  %߿X%߰`'$8 $x@%$ߤH $d߿X$߰`'ܮ4xߤH $`߿X$߰`''0%  (%0 P@(%'0%  ' 'X '$X '@<8%$ 5  X!( $",@$#0`$(4$!< $"D@$#L`$(T$!\ $"d@}$#l`z$(tw$!| t$"@q$#`ql$ ' @u<' $!Q!!4$% m'@:,' k 4 l $8*H! @!( 0!0!@!8!(!(!08!0!  0!  (!< \8 4  %߿߰߼ '@$Ů` 򏙉P%'$ <(0$BP%o"!$7$ $ G$$ ߼0߰('PBC 8 ߩ )$ !H$$@ %' ܎h'$ |' %' '߿8 %(%0% x8%߿8@@CĎDD!ʏ8  %C@@߿8BDD 8 < 8` ܎  DH( % Ӹ$ ߿8߼04 (0% x$ԀH GF8 % xE߿8'<$BN%"! %<`` %ߤ S߿߼߰'0'8 (%%% 茤0@% R7P@0L!%#%P(@*5$ % (%  0% %  (%`H%߳0߱ ߵ ߿P'0%@(%  ߳0h'(%' |߲8 %0%' ߴ@߿$x߰(߲8ߴ@'p 8%<&R4B@  @(%@0  %!'@\%%'0% x (%@ߣ߿$'` \ߤ'ߦ(% x@߿$'h'$' |d' '@߿%' 菤P 菤0ߤh ߧhGN'ߤ '@Hdߥ`'$H X@*d' ߥX@jߧL $`ߡPߣHcP@' 4'ߧ` ߦ@PߤߥH'  0%ߤ '߿ߨ%'$xߡ!L&䏙$`ߡ!P8&h@#(@###ߣhH @l('$$'  ߣh$c (h('0 '@80pߨ8xߦx' '8% |ߧp0$p8*ߨx%x ߤ8$`ߧPH@ߨP׏l'$ 'ߡP$!P'@%<h$cI`%%% |#!@Hx߼߲%߳߷'HxP&Ql0 DP@(%'0%  D %'FX '$ % EX@oX`hpTh@%' %@[tI5) %(% 0% |%`. %'8 X%Ap8P#p@*#h Ht #* %' %@ClApϮIt0%!p# %!(! $  %߼߰@߱x߲߳ߴhߵp߶`߿H߷%߾X'߼߲$߳߷'PP(%x0%H&QlD   8%@xx $ '@ ߣPX`AlhIppHt` ߼߱x߿H߲%߳߷'߼߱x߿H߲$߳߷''h<( $BFP% "!߼ ߰('PP'0%0  (%0 P@(%'0%   %$'X `'8%'X |'߿0߼ $d$߰('P'<$BE(1 %1 6"!3`'0$(0%8$ x$Ԁ@ %' ܎ %'''' 'O'H! % HC x(#߿0߼ ߰('P(0%5 x$Ԁڮ߼ ߰('P'H (%$ n$pߣ$c(&$r'`0%$ %@$-%H!&1)H+ W&2A$-#R@ % %,H$ b@%P $c$e*$f1$ n $r'`0%$ %@$r$x@0%%$ $@$c$'`0%$ %@$eߩ5H!)H+& &1! '`0%$ %@$f$x`0%%$ $P@$ n(p߳p߶߰߱($԰#߲$߲߾߰߳pߤxx@%$`߶ $x߿ߴ$ߵ߷'ߨ5!\>' 4%$(%' <%%B %*%$- &'`0%$ %@x߳pxxH%@0%x%$ߤ $߰߱(߲߳pߴߵ߿߶$߷߾'d &s !H!)1) @ @%b߳p\&ߥ' xߤߵ@ ߿ߴ߰߱(߲߶$߷߾'쏔0ߤ 0 菤ߨ0H@*@%ߩ 0ߤ ߤ$E% $4 @ %@%$3$ 8߱(8%߶X@`  %@x% 4'Pߡ0$! ߨ`* ' (%ߩ)) ߡ0a* ߣߩ8`ߨ8ߩX&siH* 쏙ߤ`(% $Q h(1 (&% & <'1ߩ @%K`` %@%$ &1#!!0! @ @%"߱ߨP$X%< 5)lqP!L@ % (%Q#@ ߦߧ@ߡ*@%& ߣ0%``߱h߰`P% 1߰`!#5&C@#P 1f!Aa0  P!@ P#(u&HH##P 1@!@ Pߤ'`(%  ߨ8ߩ  0%'  '؏8ߤ$ߥ |'@$`ߥ' |' 8%߳p߲߿߰߱(߾ߨ' 8%߿ߢߴߵ߷'ߡ0 O&sa*8!H 􏒂ߤ@0%ߥH  8%@ߦ@(%'ߤH 'ЏЏ8#ߦ#%%ߨx߱h`%1 P%#!CP#5&1#@a` ߣ$$ch&ߨ,ch&`D߱H* X%\ߤ <(%H@߿߲߰ߴߵ$߷߾'ߡX3* ߣ`Ddߨx''  %@rߩ ߤ\ߥ&' x߶߿@(߱(߲߰ߴߵ$߷߾'' $ߩ@%߱(߲߳pߴߵ߶߷߰x߿߾$%)( ߰'$V 菤ߣ` @8%8d''  %@ߨFߩ0I@&%)(8 <'p$!9!!T '(%( '8%$r$ c@߿%߼')B@t (@=(!̀$l$$$J$ n%K&@(%& +&+&b$+%A$%&8 @ $& M+&+&b$+A$%O&8 $& +&+&b$+A$%&8 L$8x%0h%@P%$n!$r$l#&.&++s$c$'&n&p&c`&&p++ `++`$g&8&n$8+ g$8& +$$p x&p +%`$ߵ88 ߳08 P  $8H`@0%@%Xh%&@%4$8$nj ! @0% !'@ @]$ L&s&*&R& t&1ߤ(ߥ `8%0!% @U%J@*$r !`!1@$l&&1&"$c$n ! @0% !'8 @$ ƮL ! @0% !'( @S$ r$c ! @0% !'0 @E$$cx@%xߤ( 0!$牨 $ %  %߳0ߵ8߷@߶ߴP߰X߾`߲h  %߱H߼߿%' ߼߰X߱H߲h߳0ߴPߵ8߿%߶߷@߾`'h%8@x%@P%0%@P%8%`%0h%e@cA$!$ r$l#&,`& `++l$$ c$n,`&"& `+l$$` 8 '@8Xx`%h%%$-$p0% /P&TCd*`*!\'(%` % x@>߿߲x߰h߱p߳`$ߴߵX'` %x@%'xFߴ $߰h߱p߿߲x$߳`ߵX' @ %@0%@@%@ 'H@ $-$ 8&@&`*'P ߦ@߭8@ $-58 菤&%$B1 Hh'$' |ߴd' '߱p@:߿߰h߲x%߳`ߵX''X ߦ@ߣ8@$-4c8\` %(%' x߱p@߿߲x߰h߳`$ߴߵX''` ߦ@@$-߬858'h ߦ@@m$-߭858߬8$-'  (0%&p(%` %ߪH߫0 z%?߿` %((%<61H&p0%ߪH H%߫0 z%( t@%ߡH%@ ߱ &1 %H` %(%8%@%% P%&1ߦ(< ߫0 z5)H&R t %@@%߬ L`!Hߦ(` %(%@%ߪH߫0 z%߿߲߰(@ ` %(%$ @%ߪH%$߫0 z0$߿߰h߱p߲x߳`%ߴߵX''p ߦ@@$-߬85/8xߦ@ $@$-߬P&`!`+!&0 @0%' ,R2ߴ` %x@%'xF $߰h߱p߲x߿߳`$ߴߵX'` %x@%'xF $߰h߱p߲x߿߳`$ߴߵX''0PH'h$"X% %%`%% h2fx$# ( 2p2$!2.22* !BB$mCQߢ0 ߣxl]ߤ "tߣx`$i ^ߡp $wBBCt ! 3*`(%&2*72* p!N*@ߨߧQH#2 *H ߤq#n0*( 'p!@00!'9j )H!$ 8` {P%ߡ@߿8? ߿ߵ߷ߴ߾߰P߱H߲h߳X߶`'Bt$CH$(ߤߥ'9ߧ H%ߨ {P%߿ߧ(ߨ '9' H%P% {߿ߤ(ߥ ''9ߧ H%0 ߨ {P%߿ߤߧ(ߨ '9' H%P% {߿,(ߤߥ('9ߧ H%ߨ {P%~߿''`0@80%%P 8%%H'% '  %@(% 4߱8 % (% 4@% %' 4@%߿H߰P%߱@߲0','(h ' ߡ8$ נ$@8%@% % (%@% '@% @ %߿H%߰P߱@߲0'<'`h$!*0!!x`% $$@%p 3@ %@8@4$D'<  ׀߼h߲ߥp߿`$xph`\XTP<T߰x''<')`?!(T'9$0%% 4 4L %8  ($<$  (%0! ( (% $` % ߱߿߰߼'0'@08P`@X( %H '$ $L$ x(%$ '$ $$ $$$$$$$$$$$$h$ p߭߬߫ߪ$ߤߩߨ$ߥȌ<ߢ @$D߸h,H߯p008%P0!߮x( $ *`ߦ(a* ߣ,G8*߲0  *`ߦ 4* 8$<G8*@(D *`H,L* P0T8*X4\ c*``8dA* h<l`0*p@t *`xD|8*H *`Lߦ($* ߧߣPߧ$(߿( !* ߹`&0*  E*`A <9߲߳0߶@߾HߴP߷XIߵ`dT0'X 'XG@% $$G@% L$A$h$ d  '`($@ kh $$I'`@(%d   %gT(߿$&$߲0%߳8 0 ߰߱' % ߳dT" ߱߿P߳8&P߰'$߳8'$!8%%   %  (ߧ  (% 4  %߿߰'0'ȏ%%$8` %xMLp@ @$C@@@,@0@%J$"4$hX %%$%@RDD* DP#DDP# U@%C*`@L(&`R \` %' |X%@%  @0H H$ $`߬cl@%< 5 `aT-H!@h#ߡh#*Ah `Bߣ $ %J#Rx!`@% Y߬P%9@H%@0%ߨ`'` %߫  @#ߡ@@@%(c  0,0 ,%%!p(,0%߬ߡh.߭ (ߥ'9O@ߦh` % ߧx,!x(ߥ%ߦh'9R` %8%ߨ`$ hߡ`4#A* h! l! Ll*`% R@j%($ '(tx$' $8.U߲ߡ߲ %!pߣp` % }%(% ` %  %߬pl߾%%߭h߶߾ߡx `߬clߡmTH@`#߭`#`,߿ %C! "(߬߭`h# ?$8!`&8C8 (,%%  -45-40!# e!# &$( `*h*- C*a 0%߮%(,߰(!`*`#0%"@8%%`# ?8!8C8!', % 8g`! `C #$ <($!4ߴ!!5ߵȎ,߷h!-(߱߳' 4$ 8 G @!@C($M $``(%G %(ߥ'9O@ߦh` % ߧxk`$   $8@%@&߰` %(% ߾T' X'( Y9@0%߫` %P%ߩpߨ` '(@%a8%#=߭h#('9` % }R %#J#$B  %%'0pTB0Ah %$C$BHL(P'9@'  D4@@%E4e0 @(% $`%xh(WLP$QD%P4$&40! 0p0`%''% |Q!%b 0 %gs0`hߡP!* ߣxb(ll `' |'<$ x'0% Ռ$p %' ~%@%îS4( %'9(%0% $ߡP!*E4 ߿40C%$ `0F"߱߷߾0EI@$0G00G44%0F0EA400C`0E0G$߶ %A$߳4!߾߳߱߶߷4A4046045E4@\ %(0(*`@ %B\A@PH##!&BT08*߰%FT%@T@CX d ߰DX%0߲߰pߴhߵ'ЎD*40=';'417'4( %'9(%`0% 8%0C`% Nl( %0'9(%8% `0%`%80߲pߴh'Џ߷P# XE4$AC ߿<6` \c ߡX Y('9$`0%  %܏0( %'9 (%0% 8%ߢ`<$B4@@%>` $ߥ`% %' ~%@%''%Q0E |@%g #h % ӏl# ## %10H40P4g􏙊` % |'0<$ x'00% Ռ$pE4߿HLPE4QD%t0 1!CLq*`x`% $E4߿ݮS4'%%%T4(% 40(%00@*80( (&R %` `%%, 0 9 %% }@% %6` `%%9  %  (% %ߵ߱ ߿(߶0߳8߲@T߰$ߴ߷'p' 0(@H%8J%%쌄X%T@%$@%8%`(% ( %'9 @(%0% `8%H!"D,%Hz H@% ; 4!@(X ,(!(#!@"H*@HK`P%F H% (#G %L$fX!@#8# 8#!HKF `P%H%G %L$fX!@#8# 8#! ߰(߱ ߲H߳@߿0ߴߵ߶8'p'8(@*H4CLH%`(%+L %! HP#b*lX# bX ߰(߱ ߲H߳@ߴߵ߿0߶8'p%HK.@F `P%H%G %fX!,X@#8#(!8# (# 4M$D,H'08 p(,hT`7H"X!@X!c# %%@"#O0x*@Q%' %% hC $>,5$! *,ߥ(ߤ@ߧ0Hߪ H#8!H@% J$ߧHߥ(ߤ8ߪ J$ @% <ߥ(߬0ߤ8ߪ X%J@%8# <8!'%߾ߩ ߿),",! %5%$ ߨp !* %<6%߰p, %PB,Sb!. ` $ A,Sa!.Ø *@߾% %@ F  C $u*@ %' h  C (D% %K$ @IG$ C C $(%L,*'ߥ(Pߤ8ߧ0@%$ 8! < P%߫Pߧ0ߤ8$ ߥ(8!SH!@%4H# 쯬$ ߫Pu%%y*ߩ ߿),",! %%5X%%ߤ  !* 0%*%, %PA,Sa!.Ș `$ A,Sa!.˜ *@߾%H%@ F  C $ u*@ %' h  C i |%(%OX%@MK$ C C $(%  0.+ߥ(Pߤ8ߧ0ߨ $ 8! P% < @#߫Pߧ0ߨ ߤ8 $ ߥ(8!SH! @#4H# 쯬$߫Pp%%t*߾߿߰߱X߲߳ߴhߵx߶߷`'Ў'%!,"5@_!*\ 'b%!,"5@!* ߥ(ߧ0ߤ8ߨ H# 8!  @#r$ߥ(ߤ8ߧ0H#@%$ $  8!$ ߥ(߬0ߤ8ߨ X%i8# P%8! < @#$$ t#ߥ(ߤ8X%@%߬0 P%i8# <8!$ X%t# %9%߾ߩ ߿̍),ˍ",x%'<$B%T "!߼߲߱'@$ Xlc` <$x'0%ߤX Ռ$p$$d1k`B(AHL@`*|;$!KLCDlk*`5 |<$x'0%ߤX Ռ$$dK1k`b&,@  %M %ߥ$h$ ̮MD0 p %2DA0! 폙@('9  %P4r@0$('9  %A$#$A"0K$ `L`$! $,! Ȏ#` ȏ('9=$ (% D$ȏD pߤX߼߿߲߰߱'@0@ S$* CLjX!k*`% 0%8#  %ML !f!*`0%$ @`%0b!@`%ML@`%#T!*a  %)0$ %)0$5T(!'K$pX$1lͮKl߳ ߴ菙<$ x'0%ߤX Ռ$$,`߬DP4@$70 *&!* `p xߩEP$ (% $׎!߳Cߴ菙H$ߥh |߼߿߲߰߱'+&쌅D'@`!-@%LP# ,H#"@+%1k`r ˤ$@(%$& p"*,`!@#`߬`&@%8%`!p$Ԍ@X%$  ,H#&*Ԏ$߬`DX%@8% @#߬p$  @# ,H#)) '&쏙Ԏ$߭`X%D$(`!8%pLP#`! @! LP#&쏙߯p߮`$,X%D$ @!@)`!OP#8#LP# 8#A$#$®A&JP߬Ԏ.X%G@$ IH@%LP#8# 'H#Z߬ ˤ$@(%T<4'0(%$B"! ߼' (4 ̸$`߿'H@ <8$! 0!!p(%%%T %@%'ߢ@ 0%  (%(߾0'9@ %߷( (% ߵ 0A ߰ % ߲߿߼8߱H'(@(%4F ̸$`'0( %'%@ % Tp4߰!߿@8`$01@ % %@ߵ@߱8߿bPV*߰0@߲vP !!*`!"* #@d#0!g#f*`ߴ&D0#0#0*߶(t߶(6tߴ߳ '`'0T 8<1!%($c  4#!5# A(_'9@'  4@߿8߼(߰0'p('9@4  ߥ ߩ @@0%)) (0)('9ߤߥ $߿8߼(߰0'p(@ߥ ̸$` ߢ@' xpT<$!p4%%%%Xo!!@ed%{H@ %(%0%P '$@%@ % (%ߣXCdhb0I r(`(4A &R@a & %(%`0%$ %`%' %@)! 3 %$8#<'8"@% %$B  @@%' % %' '@%  (%@@%I* %A#*  %͌S0߼߰߱P߲߳ߴߵx߿H߶`߷h߾p' (%  @%@% %H @(%@߿H%߼߲߰߳ߴߵx߾p'' %@'b0 P@(%'0%  |@%((% ̸$``b߼߰߱P߲߳ߴ߿Hߵx߷h߾p''`pT<`0Ah$c% Z#!4DD'<  $8x  ($ߢx('9$0%4 % 8߿"!4$9&%0!(!@&#f!C!D#!@&###&###*$`HH$&D' #& # #D* L$DLP&P(0%'9) %&%H D8%߿׀߼h߱`px`h߰p' %Ʈ ( (% ̸$`'`p08XHh<P$!@!!%`%%% PT0@% $Uvl{ߵp0c`('9 @ %(&@ (%4  %@ @%HCLh!#* 9%,' kDDL$&@#`&!0(!0#!C&H*)0 40!(' '9)@ %&SHߵp D`(%d (% ' @_(߳0`T(0A J߼P4B ߰8߱@߿X߲`߳h߷H'(ChǏ,A)!H* ,߼P߰8߱@߲`߿X߳hߵp߷H'('9)'  (%@ % Dߵp('9@'  4@LD# %'$ ߵp'#`(!AH)IL(HP@ %'9) (%0% D&GH(@(% ̸$`@ %'9) (%0% D&GH@ %'9) (%0% D`8%$0'PHhx`X%p%$& 茤8 @0h$A(@NA#( @%P &s % (%0%8% %@OߣP;ߤ(% $%%' %' ~`%@%''%Q0E |@% #! %<( %6 &AA#@ 'IHCB0@%%ߣH5 IiHhAaPߧH0%(%  ߰`߱ ߲x߳@ߴhߵX߿p߶8߷0߾('߰`߱ ߲x߳@ߴhߵX߿p߶8߷0߾(''XX%P$<H%$cЌT@#!x@ %x@%$f $߿X$߼P'\@ %ߥH' xf@߿X$߼P' 菤08 ߨ8m$ߤH 'ߡ@!0! ߿X('9 ߤH߿Xߡ@#H&@!\f##*% 0߼P'(ߤ@'9@'  4F8D,(#@* ߨ8(#* ߨ8(#ߨ8  $','('$'  @#0!8# 8#ߢ@ BX"#@5߿X(ߣ0f#C#@Nߣ0$a@ߧH@* ߣ0#!C!#'ߨ@0Tߨ@4B0F9%߼P'l'$ '!$!'ߦ@T@h!Tߦ0$#ߧHC*` ߦ0f!C##gߡ@@Ѭ(T0#$ߡ@(T@#Ǭ(T%߼P'(ߧ@ߥH4F ̸$`߿X'0T%<$c`(0! %% #!(H'98 ߤߢH߿8$ +O8''@0% (%@@ % ʀT$$߿8$$߱(AK4H!FפC*ߡH@&( 4BT0Iߴ@ E߼ ߰0%߱(߲'pׅhF$('H&L#P߾x߷pߵhߢ ߰0Bߴ`߶P0A߳H m߲@߿Xߦ ߱8'4C `4P&$L &Hp@xP$A(hA#@%@I&h(H(&R! %`(%0%8% %<6ߣ('5(%$ $%% %' ~@%@%''%S0E |@% #f %`(% %`H%$@#(@!&%H@%$0$B!&H#L!PP&'H0%(%  $߾x߾x߷pߵh߰0ߴ`߶P( (%߳H߲@ ̸$`ߢ B'@`hTP<!$B p%x%0!%%X "!('9 ` %߿$$-$hT%$@'! % l@0 h %\ %`(%' x߱p@_߿ߴx߰h߼$߲߳' %(% 0%' ' ʀ߲$$$$ A߿CVׅhH,I(߼߰h߱p%߳ߴx'P'd0%  ߲` %0% '߼߰h߿߱p%߳ߴx' ,A ߿x@0%$ $@߿$$x %x@%&$߲ $߼߰h߿߱p$߳ߴx'` %@0% '߼߰h߱p߿߲%߳ߴx'פF$(P %`(% 0%߼߰h߿߱p%߳ߴx'߼߰h߱p$߳ߴx''( kdߣP0bLcDJ@! H#C#A 7&tH0@% d@(% $d(H$` %(% ~%h@%E '8 % |@0(` %(%'90%'# 8%ߣH<(#$8aHg!*`0@G@%  %4@% D7!DFaF!F!D ߴF!!ߨ߰F !߿߷/F>!!pF<2E ׾"xF$2E߲߱׼'@D' '$xD&' <pߥ@ %8%׼' @x@ % $$  \@ %߿߲߰߱'@ D׾D' ߷D&' ߴ߰߿߲߱׼'@'%%%߰߱'@ $@% b*߳% ?߿ $@%R ߳߿ ߳0+r t@ %@%@.@%$d߳߿ .% %0!0*߲߱0$$@ f!*`%߰'@߰%߲߱'@߰߱߳'@tx $ώ$%߲߰߱'@' T<a$B%0!%% "!('9( ߿(fHaDe4b@A *$ D h!$ *C* *` A 0:C!B*@(%&$&bX,c@,#P!@!@*(!%,"!* 0%(c`߼߲߰߱߳ 'P߼߰$$߲߱߳ 'P$( (%(߿(@!('``(8TH! <X0!P$B%0 "!('9 (ߤH'9@(%  4@@%@߿`d@ % (%@߿`$߼P߰X'ߡ@1,!߰X A#"B*` ߨ@1 B#߼P$߲߱'ߩ(  $@(%9߫8 % @#ߪ 0!8#ߩ0 8#߭0ߣHl@cXL!C#,%ߤ8߿`,߮H1ߤ8Hh*ߣ8ߡ0.%߮HH #dߢ0BD(!ߤH߬H߼P@߰X߱`*߮HHh*߬(#ߣ8 aߢ BL`!`*ߡ(h#-߲%'ތ߲߼P$߰X߱'߼P߰X$߲߱'߼P߰X$߲߱''pH T0!(<0!@$B`8 "!('9 (ߤ0'9@ߥ8  4@%@߿Hd@ % ߥ8@߿H$߼@'߼@ߢ0ߡCX+,L@k`#lX!߬#,,(c`#ߣl߫(#c,#BLlX!KX*C#ߣ  bߢ!'A%'008(XHp`x<h!$0%!&E P$( '''9T0 %H%0%  ߬XL`*@%$ @ߡh*$ !$ B CߣL&h&- %n߿p,ߤ k'0'((((%)M)%JM@*%kM+%J, ( @!( # ( (0#&$&$%0C# ",@ߥP0%"4$D Pߤ0H!- ߲`$ ߿pNߢ(hc0@#(%<4d ߰,,0$߼x߱h' %ߣ8 ``!`$$$Ah#-0Ap!#߰D߰$#ۮ#0$߼x߰߱h߲`'߬Hz('H%$ߥP'9T0ߤ $<'  5m$ ߣ@a$!aߣ&!mB '@h%Hp%8%,x%<@$B 8%!0@% %4 ]"!PX %\DD*R!$ `Gp# 8X!klX&&,x X!( H%(%' (` %x@@% llX#D ߿xߪ(8X%@@% ((%` % m<LP#߿x, ,' kx$ x#8(` %(%ߪ(X%@@%NP#LP#` m<LP#߿x߼0߰X߱p߲H߳@ߴ8ߵP'߼0߲H߳@ߴ8'h`(F''9T0@%&Ex  H#߯`߮h߿x<'$!!! 4߿߼' 8%4<'%(!(H%' '9T0$@%%e  ߿߼'0'`8( 4@,0P %< `%H%)P%)!%<(5B@&%G0% '9T0`P%H%!  $X!߱ $ ߿4$a" (p߱ g߰(8#(Dg$%eH% '9T0P%߰(<5B@  *_##A ߿߼Hߵ߳T u!t#ߴߵ@߳0ߴ8C G$߲P'g!߰(a߱ #讁' %%p%`%(h%$, $. !PH#@* (A$k$(%<0%(%)EP! (%EH#!G  !(0%5%T0%( %Jh(%4@%G'C$GH+H!)1) $B$ 0%p%5(%(%A,B@%(!%T00#'H%8%$'%<$  5߿#߱EH*߿0I(  ߲(߲(%!,E!,߰ '`0%p%('4< '9T0H%05B@$  (ߨ%T02H# @#('9S0%0@(% $(%T0(%%A,B@%(!O%H!# HC@&(H#0( %T0߰ ߱'`'$?`% ! hX#@8* )A %kh! (%%#a  !$H*a#b  '(H%8%$'9T0'<  5ߡ"*? ߿'P##H##*)H!I# ('9S0%(% ߿_#߿'P'4$% m'$,_? !߾^#߿8!(*߾'@ C#'P0H(%%%Ű! %+8%%@ ,%X`P$ $ 6+2+(%@#@w0*` %1(%! % (%'@%8# Q0#Q!2+V+ 3!@6+߿P&16+`6+߿Pߵ`ߴX߰ ߲߶߷߾(ߢ0ߤ@"#߱8߳H'!$$d!8%%$<' $!`!!%$ %@%$ ( %@%$ 0 %@%$""2   $T% QB@ $ C $D@E%$ ߲(@ $ H $G$@% F߼ ߰Q߱߿ߴ0Uߵ'P'<'0>!('9W % Ȍ  %߿߼߾'0 ' %(&1W % % Ȯ %߱߿('9X0    %߿߰'0   %%?9 $  (%$߱' %  %ߵ߿߱'0'< '0?!((8'9[  %ߤ@%%H N%`XP@#$ & (% 0%! H<&s $ PHG@%B%@%@`% `%(%%  0%&$B$P!P# & @%@%ʬDɮ$ߵ@߱HߴP߾Xߤ߲`߰`8% ߶(ߵ@߱H߰ߴP߾X߶(ߤ߲`('9\ ߳0ߡ!7!߿@ @(%ߧg!ߧߡW!* W@(%߷8pc`,ߤ ߿߼ '('9\  %߿,ߤ'9 쌄߿'%(%%"(#* cT`%%߰'09  %߿ߡ!"߰'0tx $8߿%߰'0%߰'0'(0 %$$߰P%%"$Q09  % @(%P&"+a ߲߱0߿߳(ߴߵ 'P'< &04!(%&[ % %( %P@@% %8 %@%0@@%H߷(H߷(@%X a!q#c# %O t@ %'@%B99 0%@(% % 6@`c#ݬ1%F$FB@@ %%$ % ʎBP@@%BP  %%$B `% P@@%߷(߱0߰߳8߲H߶X0%%*ߵP ߵPߵP߾@߶('9\ ,'9 쌥p! ߿, ߿߼ ߴ'p1 99   %߱0%A$!AB@$c @ %B %,'9(% ߾@߰߶߱0߰߳8߲H'<$!p!!>%*`: = (t "*  x"#"*`x% $X߿( %& x%( $߿(߼%߰߱ߴߵ '@߼%߱ߴ'@t@@ A  @8% `@@8%%'ЌP<$!%!!0 Q9߿@@%tx $0"߿@8%3߼@0߼H߼@8% %  8%G@ %BG@߱@%B@߱@%߱%߰'0߼%߰߱'0߼%߰߱'0'( <$!`%!!6%tx &1x%0 $߿0 %0%߿0 x%1! x% $%߼%߰ ߱ߴߵ߶('Pt'<'@?!('9[ %%  %@c7FW('9\  ߷p! ߿, ߿߼߰'0 %<'$!`H%e!! hH%*('9\ ߿߼'0'@Xh<@$!H!!$8%%P%(%x %@%+`"&@$ $ ( 0t '9[ @% _( ` %@hcpI P ߰ (0'0%(%p ` %r '@(&i  % %A+(` %(%0% ' '@$ D:1%% FE@ %BE`ُ $% H$Ѯ'9\ @ %ҏ߷߰߾ߴߡ`1& ߱x$ ߱xߣ((@%ߢ0'9[ t  % Ȯ@c0HP ߰('9\ @ %@%$߲ppc`, d߼@߳X߿PߴHߵ8߶h'('9\ ߲ppߡ` '8(0%%%&! Y 21#2 %@%BP@%R@@ E(!E 8*$! 4$$  %SP#Cۮ"ߴ ߵ߲߿`'߶߰0߱(߳8'`tx $ D$ @ %1%$  %P #THHBG ήaߴ   L @+%  @ %`@% `%3`r@ %G@%R@@s`  A"ގDݮd߰0߱(߲߳8߿ߴ ߵ߶'`߰0߱(߲߳8߿ߴ ߵ߶'`߰0߱(߳8'`߰0߱(߳8'` ;!  )# `) "@GB@) , @H% JH  AB@)H!JKMH %% I'!  )C `@H%) P%" P%) "@GB@)8%%h%!(  `@%(`%% P% X% ,! %&Ah !X #) jP!,! ߧ('P%'P'H(<8'P?!(@%'0%'9l %% `(%@ ߿H ߼8#߲0"߳P߰(  !߱@'d % 'A ߩ !0T) '($#T'  % X""(T @#(@ %(% X%3" D .c# ߡ߼8߿H"#߳P$" "'Ch*`A !H* ߰( ߰(߱@߲0''H@<8'P?!((%'0%'9m %% H`(%@d߿H߼8#߲0"߳P!߱@ ߰(' % '@Hl 'T' X %# D@ lA lIHC  l@ %' $T' X(% $@% 菤.c ߼8߿HB#߲0߳P$A@)  @*߰(߱@'$ % 0%T'<$!%  :!! '߳(0" @% e!"!!&%)) &ݮ ' !߼ 5$߱ߵ'@g'  ͌߼ ߿ ߱%߳ߵ'@(3f g.0%G+%+%& "$ c `!$ b"H#)ft%g߿ & ߿ $c `s$$ a!H#®)x $X f)' <(0$!`%@1!!  p%$- p H%X%8%0% `:8% AX 8  H! &$ D %߼0 ߰(߱߿߳%ߴߵ 'P%J@ H% 8% H%8%   `%  e8% m%&% ' %%)'  +"Q!` 8%0%ٍ$QP# c `.`0% ` QP# e #`0%%%%%  "q!tx $$ڎ H%H% `%@k  -p%Ap `c %b$߼0߱߳ߴߵ  ߿ $߰('P'`%<*H%$c@#!+  * e&H `! ! *  #+  *"'@J&,B e&H   "'@J&,B@%`"P%`P%k`1iI')I'e@!1'@'p$ <P$!8!!@H%$( %`h$(  X*px`%( &1}P'$ T %w!7!* U'V' '$ T %U'V'@%% T@%B@߶XT0' T %߶Xߴ`߷h%߱p %ߵx߶Xߴ`߷h%߱p@% ߵxA8!!'%*` $B 0!0$&  ߿H߼P߰@߾8'( &1}P @ %߿H߼P%߰@߾8''( %0%H%% %@ @X% % (@A!0$Bb$"B ,!00( @!߰0'߲ $'߱('`d8## G8#8߰0g!b߱(R!b߲ '`B !8  &@ %% 0 $ߤߧ '&@ %%  0 $ *,߿8ߧߨ(' <'`@$0H%!%8' 4$x@VhPX pt` * G' 4%@K,Q 3` * @x@0%%% $'@1Hx@0%%% $8w x% $ph 8%b@@%ws`w1'8!phP`X t,'9 ` %a߱P߷X(!ߵ` ~߲pc ` sb@@%B@h d@@ %B@bP$D((I($(sbPDEA@߰c`Dxe$x% $hh $  xa  x&e % $߼@߿8߳hߴx߶H'x@(%%& $R'@M@ %F`bh @&(8 s`bR$Ph x%߰ $c% $8ex% $c x%% $9w'8h`H0X(@P %$ *$$b *`( t % Ǝ%:%,&!1 34!"P$& & $f% % %2@Hx`%$Ƒp $@H0񏆀xR@Hx`% $َ x`% $ %(%{x}x@b D[%HF .x (% 5%61 6HHe(!xD% H`% $pH􏄀x`% $ΎF`% $8D% $ 1 $$ %! G8&$'( ߰@߱8߲h߳`ߴH߿Pߵ0߶X߷('xt(%$ `%D `% $(%`% $%K%&RE7x9% 9! $!%99  % (%!!! $@c`x`% $h$'x`% $؎$`% $ǎx`% $8Î@%)@(%'@(80% %@(,, $&1@&&X0(F =(G %!!!!!&F  % P % (%(G( @%  %$` `%HG@ F $E@% @َ%!!!!!&Fج @ % P %B(GwG$` `%@@@ WP%)I @%@ % % PHɮa#%@(%o@0F`C$!`P%c`C x%`X%)%a$c!bB!$c!b! P%) Q %  FF@ % P %@ % P %(G0P%h%)$ %`Fn`%o{p! %_nX!F XC@%%l +0*@%B@$!+0*,8&gP  P% %ώF߲߰߱@߳(ߴ߿ ߵ߶8߷0'` P % J (%(%  D @ %a X%!`%b %%%_nX!@T XC%ll0&&h @%B@$cc#%@ %/@~0G X%$c h%! X%`C`(%)$>a$c!b!$c!b! h%d) @x%Ic h%ߵ߱߿ ߳(0%߷0F߲@ߵ߱߿  ߳(߷0 ߲@%   % ߶8߿ ߰ߴ߶8'`_nX! XC%`%a h%%`%a* P%'%  n 6%(+$C!  ""!1  $ %eT%$  %#C!AFߴ ߿(߷%*ߵ(  % %  (*  ! "%  %' %&ߴ ߿(߰߱'P0 %8( $3$c$ $$!1 $"@ %3 sT$  %$GSE$ߴ ߿(߶0߳8B$B<' $!!!%%( $ @% # $ QĮB 0%& &D  Gߩ2@! '&0(!$ %$ @# ( % ߱߿߼ ߰@%߲('@'<$!%!!e %߼߰߱'@$ ! $ IHȎ&&% $D 0! Fߥ$ !&  $   % % ߱߿ ߼߰ %߱'@<'$!!! ߿%߼'0'Ќ<$B% ("! & b ߿t߼߰'0tx $߿(! $ 񏙐tx $߿x $ ߿tx $Տ<'$!@%!! %  %߿%߼߰'@@ ( '9i $ H߿$߼߰'@<'$c#! H%%" %%#0߱߼%߰'@$ %% #h & ! AP!@ ('9i  0# H$ߢ?_  %  %߿ ߼߰ %߱'@( $'9i $ H߱$߿ 'Ќ@%<$B% "!( '9i $ H߿߼߰'0'<$B`(%%  "!xt$`  %t"x ߵq&1+!$ 1 `tx $ ` t߼߿ ߰(߱߳'@ % $܎ x $߼%"!'P`%<H($c XP%%@ :#!8dp $gl0$ n $p$s$ u@% ߰pd'Hߦ0% ߰p@߿`ߡ@(! O߲@`%&R&4Lx'S!xxߤ8@%$xf $`߿`߼P$߱H߳X'x@ %x@%$Pf $0߿`߼P$߱H߳X'@ &߿`9x    %@@%u ($)5%&(% \$ 4` %  %&߰pߵx߲ߴ߼P%߱H߳X'd' ߦ0@ߡ@(! ߰p9xe  &$L@߿`ߣ@$hG $'(߱8a&' ߼P3H )%߱H߳X'd'0 ߦ0@V$nl$pd'8 ߦ0@dߨ@$  ߰pxxߤ8@%$f $0߿`߼P$߱H߳X'xdߦ0 $@Jߨ@$  ߰pxxߤ8@%$(f $0߿`߼P$߱H߳X'd'@ ߦ0@1ߨ@$  Q߰pxxߤ8@%$@f $0߿`߼P$߱H߳X'ߨ@$  4߰pxxߤ8@%$f $0߿`߼P$߱H߳X'  dkg$l@0%$ r x` % ' @dkx@%x`0%$ߤ8 $߿`߼P$߱H߳X'' 4&$L@?߿`$\ߤ8 (%' xf@`߿`߼P$߱H߳X'E 4ߤ8' 4`%@$(t$E߿`xxߤ8@%$pf $0߿`߼P$߱H߳X','9ߤ8 (% f ߿`߼P߱H߳X'xߤ8@%'f $߿`߼P$߱H߳X'$@ %ߥ ' ߥ $ \ߦ ' % 0߿`h` %( '(ߦ(@ߧhwk< %' xe ߿`,'9pߤ8 (% f ߿`߼P߱H߳X'Ϗ('`h<p$!| !!|`%H'%x $LX@%@  %/@ (% \$ $@Q $CߡX@%B0  % 0@(%'߿H߼p%߰x߱`߲h'h@ %'8 |$ %@(% '8߿H % 'h'$ |'''  % D0P $ߨP l@ %'( $'(H%)H!<'$!zP!!x $L@߿$߼'@@ߤߦ ܌E ߿%߼'@$%<'$cyDF#!$'@$0,($ 4$H&,$'@ $ơ4@% p%x!<xC'!@%$ByP &"!0! P%ߧ(%$  8#߿ \&߼'p썤X%P%ߧ(%$  8#߿ ߼'p'<$Bx`%%""!  ' 4$L(߿ @ ' 4 % ߿ @'tx $'߱(߼߰'@tx $ۏ'0%x(8(%% &L@2\ @T ' % (%($ RE  t(@ %@6Tt$߲"*ߴ $Et % 0%߿8%߰0߱('` %(%ߦ x'@߿8$߰0߱('` %Ə("!D*`Eߴ ߲߰0߿8߱(%߲ߴ '`'0%x(8(%% &L@>\ @T ' % (%($P%@@0%TP% 3%P%@tߴ $߳"2B$Et % 0%߿8%߰0߱('` (@ %%@$ь %(%ߦ x'@߿8$߰0߱('` %("!D*`Eߴ ߳߰0߿8߱(%߳ߴ '`'PPH!X@ X%< %`%)t %)!!@%4H%8%EP%@%  0%߫X0LDD$  䯤,'('߶H߲@ H$8ߤ8', H(  ߤ0߿P,B߼`' $ 폙<'@%$Bs "! f%$ " $% $ (߼'@%߼'@$$߼'@ 0% (% ' 0%ߡ!$ ߿ ߣ$b  ߥ  '  0%ߥ @!0! ' 0%߿ <' $Bq"!*( %% *! $ @߿D%߼  8%8!'(*$߰߱'P0߱  %@(% $ %%߿BA* DBC@#*`%"!'<$Bp "!%%DX%% %(% 0%@ߣ$.c % c@c@%H$ f +!$l#1$@$.X%x H"H!)1) $- d`pP%`%h$+<o6d'L %0%ߵ  %L$.$Ja#$@@%ph@ߨphHph$-@%,$+<,6&R0!'޳@@%x'`0%ߤX $X߼߰h߲߱߳ߴpߵ߿߶x$߷߾'  @%@% ⏙&@@!@$ %(%H"H!)0H$ $4`(%`(% %@% %$ L%J "!!0$ @%$ `%phP%@%߰h P%cߴpߨ4Hߵ߼߿߲%߳߷'߼߰h߲߱߳ߴpߵ߿߶x%߷߾'i$e%d!%d %'L 0%L+&,c+cHPߤ`8%ߥ@0%  Z$ e ߵ߱ߪDK(%`0%@ % ߣߡ@a|ߧ`0%(% % @ߩߨ@S(ߡ7H3%d'L0%&  %L+@%c$,h$xph@;d'L0%%q  %xLph1.x@(%@0%ߤ `8%ph$-L$'P $D@`&! $'X &$@&($` ߤ@(% $@H%P$.@s(P߱'R 0%(%  $0 $P@(%'0%  $' @0%' '$@(% '@[ߪ iߡ`$h( c' @%@ߪ l$k' (@% j@ߪxphx$-ߡHߤ" t߰h`0%ߴp(%  @+ߪߣ#$ 'h@#d&#<H(4BB@ %70# 'h@.߱0 $P@(%`8%0%  $ߪߨHHJ%' @%@ߪ)<$!ߦP$x@%'`ߤX $ ߼߱߿߲$߳߷'ߦP<'$!h!!% 茄ߤ$F 'p߿߼߾'0'Ќ<$cg%"#!b0*߳"E8*߼%߳$߼'0 @ % dߤ*߳߿ D*߼` %߳$߼'0߳'0$߼'0߳'0$߼'0'(+!<!64$%0 {%P%Ck!ct$`%J8d0%'%D ߨ $ -%߿8 *@ %Lk H+H!)4H$$c ]%+!!4$ $(%$ +@8% k!ct$`HH$l!%߰0ߴ('`߰0ߴ('`$@ k!ct$` %ߦ'% 0#@߿8ߤ 茄ߥߤ$ +PEH#8%)*E(! H  @&  (( ߿8ߢ߰0ߴ('`8P%@ %0%0#'x@ %߿8ߧ@@ߥ$ + lߦߥ  %߿8hߦߥ | %߿8<'%$!dH%!!,%GDF0!@%HB@!* # t@ @ %߿߼߰߱'@߼߿&#߰߱'@l@ %0%  (#߿߼߰'@<'$!cH% !!=%i#$a@&@ %&R $@(%F(!߼߿߰ ߲߱'P߼߿߰ ߲߱'P @ %@%h0% | (#߿߼߰ 'P &!'! (%0!@$l%  %G88!0@$B&+2$w %߰(߱ 'P %'0 0%$w@.߿0))%x %0% $@߿0.%T'ߤ$ Xsߪ' %0 0%$l@߿0)$wx %0%0 $p@ ߿0Ē)."TВ).ߣ`bB@X%ߧH X!B@ߧߣ%aa߿0!߰(߱ 'P.2ߣ))'ߤ$ X %ߨ$C#* CTA)X!k c1g8g!c0c@`9P%@ߡ ͏hߦ$ | %߿0Ŭ`%ߨ %k 'CiX!k 1h@8!0@"$_X%`P%@߿0hߦ$ | %߿0ߤ X'$_aP%$ ` Tߤ X'ߪcX%$ ߧ'PP<`($B^ ph%%X X"! @0%' @%$ @ߨP.#` ߱x@ %x@%$ $߿߼h$߰p߲`'x 0% $ @ߩP.()) ߱\@ %ߥX' x @߿߼h$߰p߲`''  0%@$ߣP.! !(c`߱\@ %ߥX' x @߿߼h$߰p߲`'x@ %x@%$ $߿߼h$߰p߲`''  0%$ @߱ߨP .x@ %x@%$痐 $߿߼h$߰p߲`'x@ %x@%$痸 $߿߼h$߰p߲`'\@ %ߥX' x @߿߼h$߰p߲`'ߤX'@ 4$@߿ $ 4@ %'@ 4%@$ߨXt$EE߿߼h%߰p߲`'x@ %x@%$0 $߿߼h$߰p߲`'x@ %x@%$` $߿߼h$߰p߲`'T(% X'|H%`% ߡP$#ߨP$  x''ߤX @%,ߦP'9 @(%&ߤX $߿߼h߰p߲`' 菤$0ߤX@% R] $4@0@,@(@ @$$H@@@HߤX@%|' ' D $p G@ % 0' ,ߦP'9 @(%&ߤX $@߿h'0$ |' '0 4' ߿߼h$߰p߲`'T(% X'|A%`%#@ %x@%' $߿߼h$߰p߲`'@ %ߥXH%$G %@ 䌥߿߼h߰p߲`'P' ߤX&E<4B@  @ %x@%' $߿߼h$߰p߲`'@ %ߥXH%$G %@ x߿߼h߰p߲`'@ %H%ߥX@%$G %@ x߿߼h߰p߲`''$ X%`%|$ @% 8%k$` p$@@߫߿ $'Pߡka=ߡ ?ߤ`9߬d 0%0! b0B@S$,xߤH%'f, $߿ ߨ$'P|` %ߦ  $`,ߤ<$@8% ܌ߤߥ'$ ,ߨH ߿ %'Pߥ, $ 4@ %,ߧ<ߤ ($@(%ߤ  0%߬ߩ(   %  (% U %߫kl %'< $BU@"!Dx %% $%@'D % '@&D % ' @$D % '(@ x$ߩ#߿%߼ ߰'`@%x0%$ߤ $߿$߼ ߰'`$ ߡ)ߢ@$ߩ#$$<$$cT0 #! $"( $"0"x$B$"$" $<'$cS"#!߼'@ߥ  , $ 4@ %ߥ X % lߤ''  ߿ ߼'@' < $cSB#!X% l''  ߿߼ ߾'@'<($R'!%<, %8% ($@,(% $ & "   %߱ , $ 4@ % X % l''  ߿ ߼(߰'@ U %߱'<$!Q%@!! E, $@ ,8%< ($@ S,(% $| 8%&  $  %߿߰%߼'@ 4@ %ݏ%'<$!P!!% %tx $Hߪ߿.$ )H!c!C!(!TIH#,%H*$ΰ ߲@8`$,,$c%) $a#߼($ ,04 ,$%k ,߰'P ߤ Č@$ߤ  \ߪ߿(%% $KX# $(۬$ߣ!c0#߼%߲߰'P 4'ߥ$' <ߤ hߤ؏ X$@ή߭F (%0! C0c`$,xxߤH%F,$p $菙$ߤ  \ߪ߿ %M(%|@ %0%  $`􏆀,8%< $@ߤ'$ ,P ߪ߿'Ќ<$BM% "!te$߳x%߳ $߿߼'0tx $t߿'p8@4(<p`0%$!M 0%%O!!",R!@ ,e  e(H   %'߿H %(%''9''H ' ,e lX#%7rX! 8+<,/@C D( U %߿H߼0߰(߱ ߲8߳@' %`(%0% Vd T %߿H߼0$p0߰(߱ ߲8߳@'߼0߰(߱ ߲8߳@'揙 %`0%8%  ߿H4,<'$!$BKP"! ,߼' ,(%0 ̸$߿4'Db` (!%(` $$!(#a&# $$$'@#&!A$#C#F!B(#e!Cf!C$&!A0<'$BI "! e  %߿߼' U %߿<'$!I!! $@߿%߼'@XD ߣߢcC lEߥ߿߼'@$'PP<`($BHph%%X X"! @0%' @%$ @ߨP.#` ߱x@ %x@%$0 $߿߼h$߰p߲`'x 0% $p@ߩP.()) ߱\@ %ߥX' x @߿߼h$߰p߲`''  0%@$ߣP.! !(c`߱\@ %ߥX' x @߿߼h$߰p߲`'x@ %x@%$ $߿߼h$߰p߲`''  0%$ @߱ߨP .x@ %x@%$؎ $߿߼h$߰p߲`'x@ %x@%$ $߿߼h$߰p߲`'\@ %ߥX' x @߿߼h$߰p߲`'ߤX'@ 4$@߿ $ 4@ %'@ 4%@$ߨXt$EE߿߼h%߰p߲`'x@ %x@%$癀 $߿߼h$߰p߲`'x@ %x@%$癰 $߿߼h$߰p߲`'T(% X'|H% ߡP$#ߨP$  x''ߤX @%,ߦP'9@(%&ߤX $߿߼h߰p߲`' 菤$0ߤX@% R\ $4@0@(@,$H$@ @@@@HߤX@%|' ' D $ G@ % 0' ,ߦP'9@(%&ߤX $@߿h'0$ |' '0 4' ߿߼h$߰p߲`'T(% X'|A%,@ %x@%' $P߿߼h$߰p߲`'@ %ߥXH%$G %0 䌥߿߼h߰p߲`'P' ߤX&E<4B@  @ %x@%' $P߿߼h$߰p߲`'@ %ߥXH%$G %0 x߿߼h߰p߲`'@ %H%ߥX@%$G %0 x߿߼h߰p߲`''X%|0($ $ @%`8%8%% p$@߿0$߰8߲('pF,@@% $@߿0$߰8߲('pD  Iߡ A ߿0%߰8߲('p@S`S ` % '& 4@$H` % (% ߦ @? 4'@$d$QQ߱H 4'$`(% <'ߧ ߦ'' $$' <'䏳'ߤ `(%R 0%`(%  $@ %`(% B' 8߳@߿0%߰8߲('pxߤ '' $ !ߥ0*(  % ߡ ߩA&$,!aH '< $B?"!Dx %% $%0@'D % '@&D % '@$D % '@ x$ߩ#߿%߼ ߰'`@%x0%$Pߤ $@߿$߼ ߰'`$ ߡ)ߢ@$ߩ#$$<$$c> #! $" $""x$B0$"$"' <$B>% "!| 8%&  $  %@ @%߿%߼߰'@  $@ Ў ߏ| 4@ %%'< ($!=0!!%%tx0 $߿0 0%'0 D'(0!0!,(!(!߿0A#&*,ߢ߲ $@$ߡ,$$!Ь $$e߼($ (04,0$$c0߰ ',C# ,($`!0%߼(߰ ߲''Ќ<$B;% "!te$߳x%߳ $߿߼'0tx $t߿'p4@<) $!;080%% )!! ,qX! `(߼0߰8߱@', %(%''9''H 'ߤ  (%ߩ(0%LP# QP!߿H߼0߰8߱@'߼0߰8߱@''p4- <(%$!:@!!8( 0@0%H % D`(%ߧߨ ߪ(ߥ0ߩ8ߤ@߿H`#(C!"&$$ $߼$߱߰'#e!C 1,`#`#߱`!L#!!C%!Q߱",߱E!B<'$!9!! $@߿%߼'@XD ߣߢcC lEߥ߿߼'@$' < $c8pB#!X% l''  ߿߼ ߾'p'(<$B8%%% K"!D  $aT$ b q$ c $d$l $ n &$ p P$r!xD'0 ߦ@$rxD'8 ߦ@$ r xDߦ'@ ߰ @߫-k`'@1xx` %H%xF%$߰ $߼߿߱$߲߳'Px` %x@%$F $߼߿߱$߲߳'PD' ߦ@$ b$߰ 'ߪ)J@菙 % E ߫)k`2x$߲$.R}߲D' ߦ@$ cߪ)J@]߰ ߫)k`Y % E ,@h%ߡ$#ߪ$ K+lh` %(%0% ȎG@߼߿߱$߲߳'Pߡ,! tߣ$ j߰ ߫$a׏x` %x@%$xF $߼߿߱$߲߳'PD' ߦ@V$ c D$dxDߦ $ @<$dߪ-J@7߫)k`߰  % E ߡ$#%ߪ$ Kߧ` %P%@H%|&H$` p$p߲`FP4&G% ` %@4߼߿߱$߲߳'PD' ߦ@$lߪ)J@߰ ߫)k`ߡ@%$!&#2!|D'  ߦ@$ nߪ$ K߰ ߡ$#x` %x@%$ЎF $߼߿߱$߲߳'PD'( ߦ@$ n $ pxDߦ $@$ pߪ-J@߫$a?߰ ߣ$ j;x` %x@%$F $߼߿߱$߲߳'PxDߦ $@@$rߪ-J@߫$b߰ ߡ$#x` %x@%$PF $߼߿߱$߲߳'P,'9 (%F ` %@ߡ$#,&H߲$,'9 % @(% %(%0%@8% `$߼߿߱%߲߳'Pߡ,! yߣ$ jC߰ x` %x@%$瞘F $߼߿߱$߲߳'Ph'$' |߫xk`H&R %'ߧx' `ߨЏ'ߦx' |ߧߤߢߣx$!X# ߪ@+h`!0! ̮%xߣ$*$B`\' (%@F x` %@ߪ߫KP*@\` % (%' xF@ d' '@߫x߼߿߱%߲߳'P ` %ߡ,! ߣ$ j߰ x` %x@%$F $߼߿߱$߲߳'Pߪ-J@߫$b߰ ߡ$#ߡ菇x` %x@%$F $߼߿߱$߲߳'Px` %P%x'%)8F $߼߿߱$߲߳'PP' 0%(%  $0 $P@(%'00%  $@(%@0%ߤ |8% 4ߤ,p % ,@(%,&H'9 %@(% $?H %'?H  @(%&sߡa9@` e  ߤ@R #XrJ@ %(%0%@8% `$P߼$$  8%ߤ+$ߢ5k6+߼߿߱$߲߳'P` %(% 0%߼,'9 (%F ` %@ߡ$#s0%߲,'9 % @(% %(%0%@8% `$߼x` %x@%$hF $߼߿߱$߲߳'P,'9 % (% F @J@%߼߿߱%߲߳'P"ӏ\` % (%' xF @+(߼߿߱$߲߳'P߼߿߱$߲߳'P߼߿߱$߲߳'P,'9 % (% F @h߼߿߱%߲߳'P,'9` % (% F @͏߼߿߱$߲߳'PP' 0%$  (%0 $P@(%'00%  $'@0%'0 ' $@(% ' @ `'0' |@%'0` % 4 %` '@2'0' |@%` %'0 4 % '@'0$߼H@H%$+A͏`` %(%0% G@3߃C$`dGߦ` % T% h` %xx` %@%x$$Ɯ $߼߿߱$߲߳'Pbx` %x@%$睨F $߼߿߱$߲߳'P\' (%F x` %@^ߣ߼߿߱$߲߳'P߼߿߱$߲߳'P$H  @%&$@(%p 4'@@ @0%߲ '@ 4F@0%@&R$HP,'9 ߥpP %߱p%` %&R&1 4PJP*@ ߤp߼` %|H%H@8%% $p߼߿߲߱߳'P'9` % (% F@<߲ACa*$fsa0 $ jޏ\` % (%' xF@4߼߿߱$߲߳'P'P '@pPX ` %"@`%L߭,'9` % (% F@߲AC#*$fa0 %H$ .,߼߿߱$߲߳'P''ߦh ' ' (@%@ cj.``'' |@%0 $P@(%'00%  $''0ߦh ' ''' |@%+,'9 % (% F @wX߼߿߱%߲߳'P'' |@%' ( %d' 'A '߼߿߱%߲߳'P' |@%' 4` %` % 4'߼߼߿߱$߲߳'Pxx` %H%x%`$0F $߼߿߱$߲߳'PE` % &F @߼߿߱$߲߳'P߼߿߱%߲߳'PE4&$` % &F8@!߼߿߱$߲߳'PP'0%$  (%W\' (%F x` %@}0߼߿߱$߲߳'PF<)4` %&G@ %@#߼߿߱$߲߳'PJA@߼߿߱$߲߳'Pd` %(%0% TG߼߿߲߱߳'PFD4` %&GH %@ ߼߿߱$߲߳'PFL&4` %&GP %@ ߼߿߱$߲߳'P` %|H%@8%H x$p߼߿߲߱߳'P߼߿߱%߲߳'PETF&FX ` %@A߼߿߱$߲߳'P $P@(%'00%  $ߪ$ KM\840'X'0ߦX '$ߥX '@ 8%S  #'X  %@'X߼߿߱%߲߳'PF\-4` %&G` %@'߼߿߱$߲߳'P` %H%|@%@8% x$p߼߿߲߱߳'P` % (%' xF@߼߿߱$߲߳'PFd 4` %&Gh %@߼߿߱$߲߳'Pd' 'X@`߼߿߱%߲߳'PJh@Fl4` %&Gp %@ ߼߿߱$߲߳'PKp`Ft4` %&Gx %@ ߼߿߱$߲߳'PAx D @F|` % x%@pBE%` % &F@ ߼߿߱$߲߳'P'X  %@d߼߿߱%߲߳'PiE8%߫X KA8%?$F X!&`cfhJFIx+XrJ*\C#`A(!dK` @A $ C`$ J$@D$ K %(%0%@8% `$ߢP߼߿߲߱߳'P''X |@%' 4` %'X  %''X |@%` % 4'߼\@h߼߿߱$߲߳'Pf@px@x` %x@%$睈 $x߼߱߿@$߲߳'PJ(@$ K,`$ A0 $ C4`$ J<@$ KD`$ AL $ CT`$ J\@$ Kd`$ Al $ Ct`$ J|@$ K`$ A $ <'$!!!D '% $@ %@%@;߿ $<$$&'߼e7@ % H $(,048<@DHLPTX\`dhlptx|H߿$H߰ %$ ߱'@ ߼߰ ߱'@Ɏ'' %@(% $ߧ@@ %߿ '@߿%'@xߤ@%'Hߦ $0߿'<$!%%!! %߿   %߿  %߿$ DD߿( $ k,0 DD4߲  %<  %D  %L  %T  %\  %d  %l  %t  %|  %  %  % %  %߱ ߿߰߼'@'@%(H%) /)@$@8 H0%3 %(%`@8 %  PIP!%JEP%%`%d`*' X H ''.P ' X0 ' 'o ' M '' P &?,P +*B b &#`*J ,0 F*P &" &,a *A` A  BP*&#0  !F* "*&"&1 A ߡP"&R6a®BV@%` %@(%@%2TX!`%k B G*$ $A8  H%%p%&s&&h%)` 8% (* Bp*@ H* *Y !x* 8 '0* % 8* '` %j@*h% H ' d(*.H cX 'Dkp*8H nX ' *9H BX 'dK*/H YX 'x*-H aX ' C+h*&  -X ''H k8*DgX '( @*@H%h B+H $ d(*.H cX $Dkp*8H nX $ *9H BX $dK*/H YX $x*-H aX $ C+h*% -X $'H k8*DgX $( @* H%h K%`% %,(%$  $H@80(߲߰߱H߳0ߴ(ߵ߿ ߶@߷߾8'p'p(%@%0%J %H8* ! P $*@*8 cH $aP*@ * $ * b $*# J8 $ G*C !$P $**$ C  P*J8 $ *@ %cBC#' (H0 *& %0.$$D0$ *( %1'8 %2 4 @߿(@' 4%@ ߿(H ߣ8*!D* 'ߴ@߱0ߦ߲8߰ 'p߰ 'p'8(<@$!!!@ %0%% %$$$$$Y$?.,Vߴ%ߴ`% ߳  ߳ ߢt (% ߢ@ D#0$ (%d$#0  %ߨ(0D % p߱(߿0߼@߰8'` $ *@+X$5)1J %jH  (% ̮ $$4$($($((( %!00!$$$C$%6ߴ$?0$73 %?  (% ̮ߴ$$$$$%$ $ '0<0$c% #!$$߼߰'Ќ0$ $ H$ & E$$@%$ %&$H!P!)$I$܎'  %(' ','9 @%@(% x,$ ,x$  %8 %@%@@%ߥx@ % ߦ `% X%@ H* %kx! %%0&0!I%$BTFIH*߱X%ߡxP%W`  $0%'& t$P!!J$*L$ ߨ'`8%@%  ߤ %' ď< %' x'P߿!%'&  $`$KH!FP!)$BIL$ tߨ'  ߤ߿߼߰'Ў Pȏ$    Č$Ȍ(̌, Ю$  ،8ܮ0.߱'<' ?!,'90%(% '߿߼'P'xh`<' `'P>!'`%,@% %X%'9p%'  %@  (`Ϗ$p!5#.p*M`! *`*#= ;$ `9G`*8߿p$PLHD$@A|40!4v(! %Dp ,<@<\ %( $$<''8* *Y X ` %@u%ߴ@%PW! 0߿p߼߱h߲߳xߴߵ߶%߷߾`' %&h#@`p'0ߤ@%8 8%2!ߦ |@H%4p* %<p% %(%`0% x%W!S4(M$ l#@p %$$# &#"@$ Ǐ&#"@$ 폢&h#  %߼߰߱h߲߳xߵ߿p߶%߷߾`'d  %߳P߱Xߵ߰@]߲x%؏ %H%x'p`0% $菙  %߼߱h߳x߿p߶$߷߾`''h߳P' ߱Xx %H%'x`0%$矰 $߼߱h߳x߿p߶$߷߾`'LHD$1@xxߤX@%$矘ߦP $߼߱h߳x߿p߶$߷߾`'xߤX@%'`ߦP $P߼߱h߳x߿p߶$߷߾`' ( %@@%rp#`?' 8<p$!@P!!`h%$0  'x@%߿h@@%߼p߳$ߵ`߶'x' $H$' % %$#a#(!H!WXx$ +@xH%߱X % (%$ %R` %$(! %R` %ߥ($% (!R&!ߣXߩHߡ@ %)H!!Xߩ8 Bߤ0 (Dߤ0ߦPߴx߾߲߱߶@@%xH%'p߰߷ $`߿h߼p$߳ߵ`' %`(% %߿hߨ($  $# @  @#BߥX %%߷0  ߡ xA&+ 8߷߰߶߱D߾ %ߴx`(% ߲@߳x%߿h%߼pߵ`''p (%%P%$0%'X x%HPd %` `%$'8+<'6R$>$!@XaX!kKX$`$# %$' x% % `%XaX!kKX$+` $#d %$' x% % `% + $ 5ד$Ԏ5ߪ@`ߪ@H* %$' x% % `%P+ 5 #!!2$ H* &ߪ@P*@ߣ8&$ ߣ8$ $ci8$'' %߶H߲P߳X@߾`$ߨx'xߧ$ߦ $($ I%߰ ߱߿0ߴ(%ߵ߷'$'' %@߰ $߱߿0ߴ(%ߵ߷'߰ ߱߿0ߴ(ߵ߷'<'$!0!! $߿߼' '@ x%<$p$h$!C$4%,10@48d Dt@Du h@0F 4# (ώD$$ h+-`  `('DD&@% l@%XX%@%8%0%*D@(%)@$  %('( D'$$',' 8%(0% (% @ @!߯`, $ p!,#!x!m $ab߬`(0@0c`@ %(%(0%X%ߩXP% $(wp!,pCp!,$$H@ 4" d( 0c` wT@(%*D`%)@`!t@%LP#` ,H# 1$ obD!"܎HHcb! %@(%0%*D8%@%)@% @BP# "H#߳ߴߵ H 1j@(% ˤPH!#3H %@(%@8% <$&x*@4+D H%@% @(%H@(% |߿߲߼p߰x߱h'$7 YTD@1߿$ 0` ؏'('$ D$ %@(% p@8%ώ(%(0%X%ߩXP% $_( f _cX!x# XCp#, @k!#* HXH߳ߴ߼p߰x߱h' LL@ % ˤ@(%H B `# d< d?d!Cl !0d<2 <4 ?#h!6 d?`!8:<##> 1,؎(% % P$@0%LP%$ $'0@(% $'00%@(% %$$ 1 @p+ P $ߡ`p#,x#߯ YT %D@߿`!P$ *D@%8%@(% %)@L$ LP# ,H#$ ߭P@(% %*D$ &)@@%MP#L-H#%J %)$ ߭P@(% %*D$ &)@@%MP#L-H#%J %)ߢP&$B p!,x! *D %@(%$ )@@%L$  8%& ', '  (% @ @!߯`, $ p!,#!x!m $a߭`D$ ߦ@P%H%ߥX@% o` , Hߦ@ߥX oȎwp!,pCp!q, LFt H` L8Ft $0%ߥ@ 8%ߧ@ߦX($  ,H%$ @% 0%ߥ@ 8%5(@%0%$8%3$ߩH+ߥX %x  P% ௯ @x! ,@p!,؎ @ߣH0!k`!l# 3H.(% % P$,HߪH@0% @(% @H%$H؎<l@8߬`p#,x#o p!,x!j  %ߥX$  @$'0 8$Ҏ8ߥX %@%ߩH8%8$  P%$⏋H'H< $!%@V!!@@ !Tcf$T(@'0 D'($$d t )!)#)#"@8(`$ j$sT8!(!0!  (!T  ߿0߼ ߰'P  0'' %H@ oP<& & H%$ mpX 4$' mX,(' kXߢ(D( $ 00!1$d(E8! i!b@0!0! ! ! YT@%)%J'@!`#DfX#hX# @!CP# DH!)#< (%)##)!0!(@f#0%h# (%'$ ߿ ߼('`<'$!@!! <@%߿߼'0' <0$!8!!(@%%  d$m/@0%$ s x` % '@ߩ x %@%x`0%$ $߿8߼0$߰(߱@'$ *x %P%x'%)p $8߿8߼0$߰(߱@''` % @0%ߦ@ߤǎ ߦ  % l @)߿8߼0$߰(߱@'ߪ$Ax %P%x'%)X $8߿8߼0$߰(߱@'ߦ %  @-߿8߼0$߰(߱@'  j$p@%A$ߩ$ u* x` %' ߦ@"߿8 x %@%x`0%$砠 $߿8߼0$߰(߱@'߿8߼0$߰(߱@'` %' @0%@ ߿8Վ ߼0$߰(߱@'߼0$߰(߱@'$$$ '$%$#)'%Č@f!C#H#B$ $$$$ ČD"#'#)#af!C`!l@H#"!CܭAD`# l!Cc @%E `%%'(@<$!0%8%% Q!!`% %De % %@7&R &ߴ ߵ & !ߦ xx@%'j %X%ߴ%)8$(ߵ @%d %߿0%`% %'8%& @%&߿ߴ !$߼8߰0߿߱(߲߳@'p߼8߰0߱(߲߳@߿ߴߵ'ptx $h߿'8(%<P%$!@0%% !!߼0߱(%߳@߶8'p1 %' !D*` B@#%%%#(!H+ t!0%@ %T! %1 #4%@ %0% %߼0߰߱(߲ ߳@߿ߴߵ%߶8'p߼0߰߱(߲ `%߳@߿ߴߵ߶8'p'(t< %谌(!0% S8#߳%߿(߼ 'Pߪ%GH+ߥI ߤ `0%߿(߼ `%߳'P$$.p'l<$B 7"!x@@& 80( ȎFhlT ϸ`%@ %  %%T  % %  %%F߱ ߵ(ߴ0߿8߳@px`߲ߦ߼(%t߰'`8  (%@߿8߼߰'`h̏,8%8l $2$p߿8'(0(<Bt$c %%%"K#!Jp@w8Px q@ $,@@ TQĎIxI@@%@%Bx 0%$/EhH% dDl鏙 T-@$  %@ @%!@%` %  $D"% ߰8@ %`(% "߼߱߿@߲0%߳(ߴ 'ߤ@ ̈ߥ8߿@@ߤ ܴ(%@%ߤ ܴ%@%ߤ (%% ܴ߰8x@P%X%'`@%x@0%$Xߤ $H߼߱߿@߲0$߳(ߴ 'Eh̏,@8%@Dl $28$ Jp~߿@' Xh%<x($c p%%` L#!P $a(@8%$c H%!.߱'0%% ߱@&$-ߣh߱h(c`?&1%%@F*#&s%; 8%`&1 %$dVx@0%%D $@O$-&R P!߲xߤPߵ $0߿߼$߰pߴx'x@ %x@%$硠 $߿߼$߰pߴx'%ߧhs@!8#$߿߲ߤP߲߱xx@%߳$ߵ $߿߼$߰pߴx'ߵ߳߱Hߨ`O߼$߰pߴx'xߤP@%'F $߼߰p߲߱߿߳$ߴxߵ'H'0% %@kߧHߨh) 0%&@ߩh(%)G8xx@%$ߤP $߼߰p߲߱߿߳$ߴxߵ'ߤP(% X$ߦ``@߿ߤP ̈ߥ`߿߼߰pߴx'$d6$ f'B$t'ߤ'@0%% @}ߨ ߨ@ߣ%@ߡ(ߩ8$!(%)8ߡ0))$c$! 50ߤ$-ߧ8h6߫@ % ߧ$-@P%$ *$dߧ(߫$&%k xߤ@0%% $ߪ@ߧ߰ˎ ߤ'@0%% ߪ@ߧߨ 0߫0ߧhk@! XtX!8#$%k$߱ߤPxx@%߱$ߵ $߿߼$߰pߴx'߿;ߵߨ`Bߩ  #ߡ +$$ߤPߥ`0% h߿߼߰pߴx'xߦߤP@%' $߼߰p߿߱$ߴxߵ'ߤ`ߥ x%ߨ߫@%߿ߤ`ߥ x%@8%߫ߤP(% X$ߦX`߫@߿߼$߰pߴx'xp<'@%݀t(!PH%(% R'@l߿H$߼@߰P'p$ 0'$ Vl UlH ܎`ď,h$ @%l d$1Pdď,$ h@%l d$1߿H%߼@߰P'p l`'80<$Bp!H(%%%%  9"!T,$!Z@ $߿@@%BT߲򏙁pQ a߲߼߰0߱( ߾߫ ߣ$ $ j&$ C ߴ8'@ ߲߿@@ @ %߿@'0@%<$ ($! !!E ft,@%߼(߰0'` $BZ" 8 % %߿8߼(߰0'`8 󏅁'@ 0<$B %aH(%%8%% H"!H U %tD,%^Ўp% $P߰hDHbD@%߳),)` %)&8% $߾(߷ ߱ߴH@߿@߼8߲0'pޏ߰@߳1 @%ߤ@ @%߿@HՏ Ү  %'<H$Bؐ %(%% /"!D0 8%q8% %0,8%0%D (% ߴ߲߱ ߿0߼(߰ 'P쮅Dߤ %߿0ߴ ,0 @ %߿0'茷%<$c׀%H%%%% #!D$%P% @ %(% ܴ%@%@ %(% ܴ%x@8% % (%xH%% $Ƣ߼߲߰߱߿ߴ$ߵ߷'Ps`a4cp`'s`􏙊(%'$ '(J߿@%@o߳*+ 2߹''ߤ,`!(% '߿ЏtACy $'(% d@%@;@(%`9*! 1߹''ߤ"!(% @@2߳$߿tC߫``%߼߲߰߱ߴߵ߷'P %@(%0%ߨ8% ߩ߼߲߰߱߿ߴߵ߷'Ptx $`߹߳tejߡ(! `ߪ! @ %ߢI߿tx $`߿'%(<$B0%%% 8"! $ c $ g $h$ o%j߰؎'8ߦ% ߰@߫)k%H`b%߱@&.&1x߾ $߼߿ߴ$߶߷'0x $߼߿ߴ$߶߷'0$ sJx0%% $0@z  2&*!`%$ -&s&K/ % &1 %$cC@%$ dJ$ sx0%% $ @$ s x0%% $@$ d H@%ߴ!W!#&R&߳߱*ߵ`߰߾߿$ߪ@߲߫`ߨD߼V߼ߴ%߶߷'0ߤ@ߦ X$E@%@߿$ eߡH g߲ȏ %(%0% 8%߼߿ߴ%߶߷'0xߤ@@%' $@߼߲߰߱߳ߴߵ߿߶$߷߾'0'ߦ %@$$ gߪ)J@[8ߡ%&`$!x'ߦ %@$hߣ(c`k0߫%&X%kp'(ߦ %@$ oߡ(!  ߪ%&P%JhK߲`H ߤH $DߥH@%߬@$D L %,(%@8% $^߼߲߿ߴ%߶߷'0xx@%$ߤ@ $߼߲߰߱߳ߴߵ߿߶$߷߾'0ߤ x(%@%>߿N߼ lBIߡ@K,F+߼߲ߴ$߶߷'0ߤ@ߥ X$ߦ*߿ߤ@߲߰߳߱xx@%߾$ߵ $X߼߿ߴ$߶߷'0߼ߴ$߶߷'0$ sJZx0%% $0@T ߫8ߪxߡ`%Jx&$!`%k@8$ -߲`jߧx߫x)k` %$dA@8%x(0%% $ @ߧ( $ tK:' 0% %@5 ߪ0ߣp߫X$cp&%kX%J`0$-߲X#ߧpߪp)J@r %$ dK@8%$sA$ tx0%% $0@ߧ׎ x0%% $ @ߧ $ tK ' 0% %@ ߪ ߣh߫P$ch&%kP%J` $-߲P#ߧhߪh)J@L %$ fK@8%$sA$ tx0%% $0@ߧ׎ '00% %@ߧ 8߲8ߧRP!W!8#$&R$X߿߲(߰`߾ߪ@߫`G1$ \ߤ߼߿ߴ%߶߷'00߲0ߧRP!W!8#$&Rߡ߰ ߾ߣ`߿ $(@{$ ߡ ߲$ 4' %0%,8%'ߥ Р%Y@;@% 8'߿߼ߴ%߶߷'0 ߲ ߧRP!W!8#$&R(߰ {߾(߰`v߾ߦE % X$߰@%@߿$ * `ߡ $* @߫`߰$ D@@% & VȬT$D Eߥߦߩď, %ߨ߲ d$Z߿߼ߴ%߶߷'0 %x@%' $@߼߲߰ߴ߿߶$߷߾'0 %x@%' $@߼߲߰ߴ߿߶$߷߾'0 %x@%' $@߼߲߰ߴ߿߶$߷߾'0x %x@%$磠߲ $X߼߿ߴ$߶߷'0ߥߦ߰ % X$߾5ߧ菇x %x@%$ $߼߲߰ߴ߿߶$߷߾'0x %x@%$ $߼߲߰ߴ߿߶$߷߾'0ߥ % X$ߦ߿Џx %x@%$ $߼߲߰ߴ߿߶$߷߾'0ߤ x(%ߧ@%߿Џߤ x(%@(%߼߲ߴ$߶߷'0ߤߥ x%@%߼ߴ$߶߷'0J߲߿߰߾ % x(% ߿߼߲߰ߴ$߶߷'0 %ߥ x%߿ %ߥ x% % T'߿ %E x%߿ %E % x߰ߥߦ % ϸ߲߿Џx %x@%$x $X߼߿ߴ$߶߷'0x %x@%$磐߲ $X߼߿ߴ$߶߷'0ߤE x%@%s߲'<(0$!Ð%8(!!XHP@,t &sZ 3 %@ @%&"%p@ @% %XPH@0D`%,&^Ю%``%1U %@ @%%#sDߵ`߼0߰X߱(߿H߲8߳@ߴP'@ @% %' <$&!x%$0 x@%'@ %H x@%'H %L x@%x %@%P x$@'P %T x@%x %@%X x$Px %@%\ x$`x %@%` x$px %@%d x$߼h߿߰ ߲߱'@'Ќ0D<@%$! !!G @%߼߰'0d0+$D    %߿߼<'$!0!!(% <$߿%߼'0'`pX@<h$!`!!@%P%%H  %D$(d`0x' %`@%x8%&F $'h 4ߵX % 'h %  (%@$߳@ % T'h') D % p߱x߿P߼h߰`@%߲p'  %򏙏D x@% @%bP*ߤHj  @0%߳HS!`߳@'p8@0<T$BPH% % % "!ߡ0(!߰@ l$߼H߲P'Pexߩ0))2$礠 $4ߦ $H!)P!$I( ߤ ߱1 A)`߲P%[$deB߰@߲R,( @ %ߡ0A*߿( n@%߼H$߰@߲P'1 ")Ci% `Ed%󏙇X ܴߤ@ % ߫Xߩ0b!$ci*`Aߤ '`ߦ d !ߢ߼H߰@߱߿(ߪ8߲P'$ I߼H'߰ 'X(F   %߬8 %$  ߿(߼H߰@߲P'߲R(RR0( @ %ߡ0A*߿( #@%߼H$߰@߲P'߼H$߰@߲P'߼H߿(߰@$߲߱P'ߤ  @(%߼Hߣ8߿($b߲P%߰@'ߤ  @(%߼H%߰@߿(ߪ8߲P'$ I'<($!0!!@ %  %& $%& % @$  \ %  %ߣDߤ$# p %߱  %߿ ߰߼('@  $D@ %@(% %$'Pp%0 x%%Bl`%<h%@$!0H@9!!8$$ 0(H%'8%0%H(% ,'$ x$i$ @ %K, (߿H"%D((%߼@߰8'A(ph`XP  ߥ0߿H߸P߯X߮`߭h@߬p߼@'毃 p %$ K͏ ߢ08Bl$<'$c"#!߼' `$s(`f e %@!b@H@!$BHH+ &1A'$cq!ct(%$BE`h@a߼1!4߱iߴ%)i߳' eia1!!$(%#ȣ$t'Ѝ e$(!' ߤ߿@(%t [bߦ(]( ( '! b($$`AQ!X߱Fߴߩ! ,$' ߳ߥ'9u'f x'$ ߳H%@%ߤ$$$ g 菫ߪߨߧߤЏ،H% gߤߢ'F߿߼' ߼߱߳ߴ' ߱Iߴ%H!I @ %߿߼߱߳ߴ' tx $؏ߤ߿Tfߴ$f'`<$$cPX%%Q#!$$ $H߼X߰H߱`߲P'K,߼X߱`߲P'( 1C#I $F f:T(t0%h(%  ܴ %@% % ܴx@8%H%x@(%%0 $ƥ߼X$  ߿h߰H߱`߲P' %h@ D@(%Fߢ@߿h'9j %h ڤ@(%߿h߼X߱`߲P'@ h E'$D P%' H%8%','0<'(5 @߿h$0 $tx0% $@$ ߼X߿h߰H߱`߲P'߼X߰H߱`߲P'ߩ@)X&ߡ@!\&*($Cx@0% $`߼X$߿h߰H߱`߲P'@%  %  (% D % p ߿h߼X߰H߱`߲P'ߩ@)L&($ A*x@0%$ ߼X$߿h߰H߱`߲P'8%<@, %@(%$ $r| % $$  % %,@(%8% ($rȏ쏙,'9x, 8%  @@%@%8  %@0% (% D % p߲8 @ %쏙 p %$#ԏ$<'$c "#!߼'0$$!(% $xtߤ0% $߿$ ߿,$ߦ x$iߧ߿ ߼'0'x$$@%H%%$% gD $($$ D ,E0C4F8J @%-BP $lx`0%$ $@5$c.l2*񏇀x@ %x@%$ & $LD'$ `0%@!$c$$ x@ %x@%$P& $6D'$ `0%@ $c$ #x@ %x@%$紐& $"Dx`0%$ $@$c`@(%0%ߤ8  8%W菙'$ `0%@$c$$ xx@ %x@%$& $D'$ `0%@.l$t'Ȏ$ `0%@D.l$t'$ `0%@$t.l*E* NߣX`$߬hՏD $)0$a@%$c@% %' 0%@$ )$f$ i $t@ %x 0%@%x%$x $`D'$ `0%@$x$ ُx@ %x@%$綨& $D'$ `0%@~$ y$%@ %(% 0%' ʀ'$ L$Xߡ8S>$A0ߦ8'90(% % ̌zDDߦ800DH'9谌8I !(!0 ,(#$80#8x#DעFa׀L!F !0D#!.l$ b%*%%%* %& %!0H0&1ɰ&ˠ** 4ߥ8@ %&'8 @4$ <׍`@߭880h!'9PD`8 Fc!F F@ % (FgD.x.$$x@ %x@%$Ў& $D.lI*)x@ %@%x 0%$ $D.ly$ɏx@ %x@%$h& $񏙏D$񏇀x@ %x@%$& $㏙D߬80D!!D#DFፌFaׂDF#BF!L!F  Dߨ8 D &!x@ %x@%$& $Dx@ %x@%$(& $D0@ %x'9ߥ8&' &( p%J 10'9ɰߤ8' l% @@%߶@D0'9ߤ80% <%ՏD0'9ɰ%ߤ8' l% @0&sˠ@%' `%@߷PzD0'9ߤ80% <%D%߰80@ %'p'9@%&'ߥ8 p&`H%@%x8%0%D $PD&߬H 'ߤ8 l %@F,' %@F,E$*$C0A(#* %`*G0*`D( * * %%%%$0'9ɰߤ8' l%@b@%! _%%%@ %%&s(!& 4,l`*U%PDT'`& @ %ߥ8 <%@D@ %ߥ8'h& <%@D0'9ɰߤ8' l%@6@%0 &1ˠߤ80,($ % 94ߤ8ׯh(% ׮`ߤ80,($ %ߡ8?p'7?p  %@@%D0'9ɰߤ8' l%@ DA !Aߦ800@H'9谌4I !(!, ,(#75$߰8 0D!D`#DFaF׀DF!FL@F Dx@ %x@%$0& $D8,#4x#DעFa׀L!F !0D#!0'9ɰߤ8' l%@@%0$ &ˠ' %@@% 8 H0%$@ %ߥ80%'H ' @aDHLߤ80,($ % 9Hߤ8L(% Hߤ80,($ %'ߡ8,00@!D`#DFa!F׀DF!FL@F D0'9ɰߤ8' l%@p@%0 &sˠ 8 [<X0%d@ %ߥ80%'P ' @D 9<ߤ8(% Pߡ8!0 'ߣ8c`ߤ80,($ %' `%@@%CDT'p& @ %ߥ8 <%@􏙏D@ %ߥ8'x& <%@쏙D'@ %% %@䏙D@ %'% %@נׄ`F$2EסF$ 2Ex% ҮLߨ8 @ &H!$.x*  &0 %!0&RɰpG&1ˠ.x;$x@ %x@%$糀& $D$'x@ %x@%$@& $D.lu$8x@ %x@%$H& $D@ %x@%'& $p$ @x@ %x@%$p& $$ P&o'ߤ8 l@%@@%ߤ8X'  %@@%ߤ80,($ %ߢ8B@@ %(% ,% 9ߦ8(% % &$6ߨ8 7& %߸8  %` `%ߡ8!0߬8߬8p4cp߬8ߡ8ߡ88p 78pߡ8!0߬8ߣ8`߬8`ߡ8߸8`ߡ8!X߸80ߣ8c\p'X` `%ȏ߬8ߨ8Ǎ߬8@%ȭ߸8HDT@ %ߥ8'0 <& @D׭0T@ %ߥ8'@ <& @D׭@߸80@!D#DFaF׀DF!FL@F ZD0'9ɰ (%ߤ8 l'@0&ˠX <' %@@ߣ8a bߤ8H0G,F(E$ %Dx@ %x@%$`& $D 98@ %ߥ80%'L '@DJߤ8x@ %x@%$8& $D0'9ɰߤ8' l%@ 0&ˠX 8' %@@d@ %x@%'@& $D'@ %% l%@wD@ %'% l%@pD)&$ m $dx@ %@%x 0%$p $X_Dߥ8@ %|H%(8% $" &'H DD(H%$ +x`@ %@(%0% ' @<ߘX$dߥ8@ %' 0% T h@ %xx@ %@%x$$Ʊ $%DY 98@ %ߥ8@0%'T ' @DT'H DZD.a $"x@ %x@%$糸& $D.l$$J0@ %'90$&'ߥ8 &: %ߢ8@ %x@%'& $籈ݏDh@ %@(%0% Ȏ' @ՏDBX @ %߬8j%(ߢ8$ B0'9ɰߤ8' l%@@%0 &1ˠߤ80,($ %ߤ8 ױ90װׯx(% ׮pߤ80,($ %ߡ8?p'7?p  %@@%Dx@ %x@%$結& $D0'9ɰߤ8' l% @=`0&ˠߨ` 8 @@%$@%'߸`,ߡpX, $@%0'9ɰߤ8' l%@@%0&ˠx% 0%`!( &$!8  cC8 !8 $!8( ' %@@%%$''$') 'H@#@& !X%f!h&% m @@%M c`8% %%/-  P% H%B0%P $$BB P%p!M( %$!Fh& %    %!a@%M  % %%am $$!A!-( @%B$!Fh& %    %!a@%M  % %%Bm $$BѬ"@0%, $ @%0'9ɰߤ8' l%@+@%0 &sˠ' `%@!@% 8 D0%$@ %ߥ80%'X ' @ߤ80,($ % 9Dߤ8'(% Xߤ80,($ %'ߥ8@ %|H%(8% x$"菙  %@0%' $@동04)d@ %@(%0% T' .l-$߰xx@ %x@%$& $߼߲߱(߳ ߴߵ߿߶0$߷߾'.lg*Px@ %x@%$h& $kDߥ8@ %H%|@%8% x$"菙  %@0%' $@ߣ8)&' %@`߸`x'@@ %@%$& %$ p t@%r$߹` 0%9 98@ %ߥ8' '+Xh %' 0%@l)0'9ɰߤ8' l%@c@%$ h0g, f(e$ߤ8 %y y 9 @ %`0%&( ߥ8 &Jߤ8h0g,f(e$ %CD0'9ɰߤ8' l%@;D( F ߤ8H%@8% .&x@ %@%x%$& $ݏD %' 0%@M) %' 0%@P$ i ) %' 0%@S$ )ߩ8)` ߤ8(0 ',&( %$߬8`ߥ8P'90H %LP#+H# @T 8 @!L8!@@8@0# (#叙DaHxxLllT۬aPx@ %@%x%$@& $Dx@ %@%x%$& $~Dx@ %@%x%$& $rDx@ %@%x%$0& $fD0'9ɰߤ8' l%@@%$$ *&ߤ80,($ % 9@ %0%8%$ ߥ8 &( ߤ80,($ %ߣ8ap4!apߣ`}${D0'9ˠ '@@%sD$ @%L3$ 0%@C%> ߥ8tFt$t@%$CC $&( &0% @ %@Q  %D0ߤ8'9ߥ` 5Dߡ8ߣ`!`#0߸8 dh!#!Ca*ߡ8' 8p0ߤ8'9ߥ` D@ %x@%'@& $ˏDߩ8)` &'H DD߸8ߡ`l p$0%( ߤ88%H% x r߬8X!\ߤ8 0,( $߮8p5p'H D׏D ߤ88%@%H% x L߬8߭!)`!&a!x X` c %8 %) %! $!a(8( '<$!_% !!  @ @% %@ @% ߿ ?9 9 (%  %$&!$߱߱4  ( \ T|8%(% $" %@ @%߿ ߲߰߼'@'@hX%|H%`%P%@%x`8%p% p$"@߿p$߰x'Ď Ԏ$@p!0$  LFD<4'  4  (ߢ<088!0!4  (! 0'9 % D$8<40K,T'd'` $@`߿p$߰x'#xߤh@%'@< $؏ <d@ @%߿p$<߰x'4d&, @쏙4d&0 @㏙4d&4 @ڏ4d&8 @я d0'90 % ̎p5"p D@ %@! 8!߿p%߰x'%m$'<$!\% !! 1 9 9$ @%8% 0%(% @ h%1ߴ p5p D@ %@! 8!߿߼߰߱'@'P<$![ % !!#0c`~ph Dp1x&$0@&R` % % %p`(%@%$ p % p% qp1  %߿ߵ H @ߴ߶xI*߳p`(߲h߿ߵ L Dߴ߶x0*߳p߲h"D 0%@l !L!f8!(!0*(#F8 %*C#!( 0**b`*  l `*V$ H@8 V01$ $$ `p%*D$ %)@`! @%LP# ,H#߿ $ 0% ˤ,@(%' % p$߿pD$L$@0f Hp0'9P T %߿߼߰߱'߼߲߰߱h߳p߿ߴߵ ߶x'߼߰߱' ˤ(@(%H@80H%DߧHߦ8ߩ0ߨ@0#`% %+ 8#X($<%$< l$PߪXߩ` ߨ@Hߧ0@(%4 @#$ 8#@5߫Xߡ8$ %IB@+ߡ8H$*ߦH %C(f*` ߡ0L,`*ߦ@C0f*`L H* $C(Lf*`$L,@`*$C0Df*`$@%߫XߥP߬@ 4& ߨ0$ P#4 ߪ`@#H#`# HߥP |$p:߿(߫Xߪ`@%Y ߩ@9ߨ0 %ߧP@(% ߢ($'$ <$BV0%W"!&$ $$6$ A   ߼߰߱ '@1 ߿-  % (%X%P%H%@%8% 1 [p0B@0(% $H0 % Ӹ$߿߰ $ 0'9 % D$ ߿$" 0'9 % D(% ߿ 8% %0!(!@! 8!ߤ0* ߿*@ #@e#0!f*`&D (!0#0* p 4!p ܎ D߿0p'90 %4B ̮p D@ %@! 8!p 7pk߿<'8%$!S`!!߼'  % S߿<'$!SP%!!%p0B@@j*` @ D&H* DH* HL*@߼L߼߰'P߼߰'PLHD0(% @ ̸$ p߿5) p<'$!R !!*%% %(D% %@L%%ߵ ߿(߼߰&L߱ߴ'@0%ߵ ߿(ߵ ߿(ﮄL0'9 ( H߿(<'$!Q0!!@0߼''9  H߿ ''4@XD8LEF 8F0@%@ %ߥP'(& <%߿@߰$߲߱'׃`ע(F#'$  $ % %a0*P+%)('!$$$\00#1!0` 0!  cAAP!$BJ$!`J @%$0%`F@ %(k`w%$$b$Í(!!%!!#!!"!!%%$$$b?$H)!!%!!#!!"!!%$$$bԌ́(X!k EP!J h! `!``!F ߰0tD @%8%8`(% ߰0߿8'-߱(߲ ߳'P @%{P߲ ߳'P8  %߿8߰0߲ ߳'P(8 %  ߮@%l߿8%% h!- $K`!, %k`!, %kKP!J*'Ќ<$B5% )"!&`00% x$0߿ @ H0 G,F( % E$߿߼߰'000%$ x$0߿߼߰'0' %% 䌄$#߿߷00% x$0߿ @ H0 G,F( % E$߿$p4!0"@ p߰'0߷0(% ̸$p߿4p'`%h%%d`;`P%q( l@ %1`plpD*@(%@$(%h@0%dhd߲* (0',&( %0%$ `%߿0߰߱'` h0(g, f(0e$  % ߪߩ ߧ(߿0 (̏0$08% $ ߪߩ ߧ(߿0@%`%X%`<'$!2@!!Y 9@ @(%$߼'0`0% 8%߿߼'0$߼'0'Ќ`<$!2%@ !!H0G, F( % E$߿߼`߾'0׀`F h>ׅEF aD0F!'F !FEF1F A F'1F'F(3F FF 1H8F F"0׊F"!F$F&>F(*F#>F+F jF!F0bF(HF B F,XF Q F D@F D D&#(D #$F!,f!0Ԯ@'p80<@$!$(!!'L %%'%ԭ8 %L` %P''  H*߿@X*$,<,?`%$<$?lJ d` X` % \(%l4 P#H#"߳ H % @(% ߿D %@(%X%$Z ߿ d`( %8%0% l߿h4 HP#"'H#H %@(% ߰( ߿L %@(%$ ZX% ߰(߿߼@߰(߱8߲0'߳ ԩPԧHhԦ@<'$!"ԥ8 !!XDׂFaF"BF!J@F!9F!1F!)AF((>ׂ`F'Cׁ`EF'AEF)S$E.F$8ԪHF$R@F(I>F$PE'F(>Ԯ@F$rF+b>E !F$p@԰PF$F-{>E l` % EF- >EF"2>EF$F#c>E F%@>F&J>F,{>E F+i>E EE $$X<'@$BD"!ׂFaׅ`hF"BԤ8F!(RF!!ԣ@F!ԢH(8F!ԠP(0' F!(% @9ߣ0chߧ(צ `4ׂߤ0l0ߡ0!8#HF!F#@L)F"BF!)AF )C'@(PF'@F(9LF"9F'BF&BF'!F&!F(BF%)B׆hF((F&'D*D) $׾ׄF&(F>F F$F$F$BF$9D)@xD(8'D'$( D&׾`#\7 %' 0%x'X $ %x'8% $ƺd %@(% #\@߰x߲߿p$߼`߱h'' % 0%d@(%` # %@߿p߼`߰x$߱h߲' %' 0%߼`߿p߰x%߱h߲'d %' 0%p %@(% %Td@ ߼`߿p߰x$߱h߲'\ x %0% $\ %' 0%\ԫԊԅԩF+P2<'F Q$!F%I>F +F!!F #EF)*2F,kF SF ZFF-a$ P@%@$ F !>E ԇF' >EF";>E $ԦF&(>X$H%F& 2`K8&F#1>EԨF(>E F!C>E $   $% $ Ԩ$$EԇF(>F'>C&@@F##>E %F(82F'BF$*AF 3EF$2 F'>EF!:>E%$F+RF& F!2E LJaF+)>E F)2>EF K>E %F%hAM* aF)0>EF"I>EF-b>EF+k>E F'2AF*JCF$J@F(8F :F!;EF!BF-J>EF&c>E F+0>EF& F*F)@F))>EF-J>EF$c>E F+ >E%%%'Ԅ <F$>$!p%$%XF uE!!ߣaF!!>E ߪքBF$>Eߡ#F##>$ m$(& Q``%D'%c0pPז$%& ߪ%a %kxh9J$-J Y&F68 % (%8%'F ߩx <%^ߡ` ߦ׹ ׷$H' @V`ߣt!$cpeߧ@l %(%8%ߨhF ߩp <%ߦ׽ ׻$H' @V&s&1ߪTP!&%JPq ߫ߡ~&$A߫ߣߪ`@ %ע @נ0ף(ס8  % (%ߧ'F ߩx <%ߣ$'F69&F61%F6)@$(ߥF6!' Vߣ߼߲߰߱߳ߴߵ߶߷߿߾%״X׶P'@ %(%ߨhF ߩp <%ߦ@ %(%ߨh`0%F |ߩp@ߦ$` %(%8%ߨhF ߩp <%ߦ$P%׶P߳߰ߣ߱P%߷j+߾߼߲ߴ߿ߵ%߶״X'@߼߲߰߱߳ߴߵ߶߷߿߾%״X׶P'@߼߲߰߱߳ߴߵ߶߷߿߾%״X׶P'@׉YtX!lF)BF)ckߥ׶PF)Zj߳߰߱F)Rh(߷߾F)B' ߿߲״XVߵߴ%߼߶'@'<($BP"!% ז0P8@ ($P%F džH!F F$F IF*H&F )E FF)CF)AEF'A%F,ZF XULZOA!F+@F*cF!cMXXaMLYF,+QF!QEF'AMF&HF(R&E F(<eF-IF-A׾P׼H׸@׺8ߵ0߱(ߴ ߿2߰׀`߼׶'߼߰F ׶''80<H$!P!!(%%@%$ <%߿@@P@%*&`& ߲ @ %(% 0% <%b*&!&R$!2@ %ߴ߿@$$c,߲߲ߴ %(%ߵ 0% ,ׁ߳`߰8߿@߱0F!2߶P߷($E ߼H߼H߰8߿@߱0%߶P߷(''߼H߰8߱0߲߳ߴ߿@ߵ%߶P߷('߶Pߵ߼H߰8߱0߳߷('߼H߰8߱0߳%߶P߷('' ԖԜ8<ԚH$! Ԙ!!׎F<0F mF6@OPMk9@P( F FF4@׏F:kAF/kBF-CF4À׬(F6sPF/s F.cׇhF:ߢ@F6߿PF 8<׾סF$<ׂF FE F4F%<@׀`߼H״0׶ ׸׺8׼'F%C׀߼H״0׶ ׸߿P׺8F (׼׾'F!EסF%CF%9N1F4 ׁF!F!1F(״0׶ ׸׼F 3<׺8E ߼H׾߼H״0߿P׶ ׸׼'׾߿PF 0׺8'ԅԦF%0><$B ԤE"!ԀF$>E F% <ԂԡF" >EF% <ԠԃF >E NF% ԊԬF*b<2`F%:F'*@'hE 5 ԎԯF.TF/sF2P<%E F) F(L!F'>%F QFE F0`EF+CF$IAF2)kB8F>s %%M{0&s@%Ma&@8%MЋ&R M{auD׾׼ ׸(ߵ0ߴ8߿@߶H߳P߲X߼߰߱'$ (X%i<h!$Bu"!-DP %.h%FRrF jFD`Fc!F r`0%%F*cF,AF,a F'9BF,F&BF%L8!F%9F&`F)0LaDL#aF!́F*(F,F&BF%L8!F)8L!L!$bD$F+AF+Y F'9BF+F&BF%L8!F%9F&XF)0LaDL#aF!aF*(F+F&BF%L8!F)8L!L!$d`$F,pAcF,ad F! BF,F&!F%Ld`F% F-Ld`0F&`Lb́`c(F,F&F%L!ca8F-L!L!` %F [DFF*dF#!F#qAf F#F%(BF"1F!!L)!fF!(F-!L1!g0F"L9!dg(F#!F"9F!!L)!gF-!e8L9!L)!'`!h `ԭ`!Հ`<H%$!XF-2P% %p%%@E7!!ւՁׄF" 2ׁ E/ׂՅF-)@F$)BրՎF sF$sփՀF!LbրՃF!L!փրF!Lb փրF"La(ւցF"@F$B0րփF 'F$$`8@ (A`%@$ցAր&R@$(A ל0!xך(ה %$Vט$W԰!ז !`U0@\4ш!&(pF#F6F!F6F8LtF4LXJ F8BL4a (F8L!( F.k@F6kB0(F sF6s8F$2EF 2E  F$2E(F#2E`L@ס0Aנ8&R@&1&'0%ߤ@ D`8%ߣ@s!4'(% @0%ߪx PR!`8%ߤ@ &h&s F<Lzh (F<LZ( 0(8F<BL:aF:L!׼׸׶׺״߷߰߿߶߼p %߱h߲H߳PߴXߵ߾`'L֎&h`8%&s ߤ@߿@4ߢ.ցL&h`8%F +F ߤ@0&g0%' Dߤ@ߢ!߿@&sץ4Eפ&F(%' D!ߢ!߿&RH! H&H!'0  <$!(F%20%%8%%!!EO!hF 2`HEH@Xל םTVF<F ߥ$ ߡ0c`%x +1k`x!x| %8%0<&1(0 $- &% H  0%0'9(ߤ  (%߿H߼ %߰@߱'x %x@%$؍&, $߼ ߿HH$߰@߱'08%<ߤ ($- (%ߤ  0%ߤ  ߥ Uߤ H<'$!!!H %H@%߿08%< ($- 0%(%  HH    (%H߱ U߰߿߼߰߱'@ׅׄԣ@׆`Ԣ8ׁ׀F#1>F"0>F$(QF F#@F"F MHF D@EDLPx $!T-B P@ AP!A'H! C8#0# !0!,($B$(AA@ D$ (H (!C0#0# I!0#C8#8#0#8# i!C8# !  C)!0#C8#$0($,$<'$!!!H(  %H@߿ ߼߰('p($PDpDh'Fsߤ' Fka$ ( 0H+H#߫ ,Kp#8, <m@NDi (%0%8% Vd @%H T߿ ߼߰('p0%8%ߥ  @%߿ $0D@D0,(FB!'F1D8D <F((<$!@F9F!!!!ׁhEF'+F%CF%9>׀`F!cF$F$*<ׂ`F%3>׀hEF&+AF%#AF k@F,QP ߿߼'0$D F!!F$(>E",D8F9F&9>%EF$0>(D@FB!F(J>E 0DXFZF*[>F%:>E F(Q>E F)[>E EE $$ԡ@Ԡ8F/ALF.MaD'M!<F$!@!!8F0F DLPDFF1F DP0'9(  ߿߼'@'Ԡ8<'0ԡ@?!0F/@'9(F.@  8߿߼'0$"H'<'>!0'9((%%  XX%0P%H%@%'9)8%0%(%  `X߿߼߾'0<'$!@!!H% ЌX@%08%<H ($- H    (%H U߱߿߼H߰'0'$(<($B% %%%% |"! X T#P#L H D#@ < 824$ !x t p l$\ǀTǂ\0%$ .ǁX$ -*"h$&!d` % # `0GH(H!)1) 8%$$* $̀GH!B0B@%$00%8$0 %@(%'91@ 0%8%8  P`@%@H %0@(% 0%H%'948#@  @!߰0ߴ @ ߿8ߵ߳(߼%߲߱'pH@ % ߰00'97@ % (%  F߼߲߱߿8߳($ߴ ߵ'pH8 @ %xxx %P%( F,%)$缘 $x߼߲߱߿8߳($ߴ ߵ'p,8 ',' ,' ,' c߿8'Ph<H`$!P!!%%Xp%%%2y*@`/x %0%0 $߼`߰P߱H߿0߲p$߳h߷X')8(!(C%$<0 @0@  8( "<߿0ߩ@)88( 0T!Π'<@(% %%8! <$@(&&VΠ$lߴ(ߵ ߶8ߴ(ߵ  ߶8 l$p p)\!Z0'98@ % 0 (%߿0߼`߰P߱H߲p߳h%ߴ(߷X'߼`߰P߱H߲p߳hߴ(߿0ߵ $߶8߷X'($l48%?!8% 0x&$$pu&  %'&RM (%&s %' 4%t~2<&R߾xߵ ߿0߶8x %0%0 $߼`߰P߱H߿0߲p$߳h߷X'0'9MP@ % T (%02<'<$B"!H%%%x  %`ߪ@(% %|H%ߨ@8%ߧ p$)@$ ߿߼$߰߱'D@z$L P@H$ @ 0 \L߫5k@ߥ'  ߤ`hߥߤ`'  pTߤ`  (Xߤ`%  (߫hx߬p X T@B(Ae $dxl@\f:p@&f?f0&0fx %x@%$P $8߼߿߱$ \߰'0'9MPߤx T(%0'98ߤx 0(%߿߼%߰߱'ph$xA<l`<@ l\l80!<$C0@!p<(! p\p$g@'<<$!P%%!! ߿D ߿H D %߿T  ( %߿X %  (%߿l߱ ߿p߰ ߰߿߼'@F4&1ߡ 0F4<&s&RF-E 4!$!1k@Lߪ @#&P$ j߫ @+ߣ P ף `ס פ ע  ߪ @* %@@(%%$Dp8&' ߩ , F4)F,F ߿ XF) F ׶ H׸ P߿ X߾ h߱ p߷ xߵ ߲ ߳ ߶ ׶ H׸ P߾ h߱ p߷ x߫ Pan`!oՍՌ߲ ߳ F/kA߶  F.c @DׂFaLy׀`F4 F$Qߣ $F ` F!l$ ,ߦ ׂ`F F4$ F X ߿ XF)8' < $B%t %) %(%  "!`x($(C '8 H%@%0% @<@(% <@ Dp %P`H%L Fs@%@ ߿ \B ߡ  *'#߳ <߼ ߰ ߱ @%߲ '  % ߰ ߿ $l `0%RP&ߡ $ * ߿ !  x 8@%ߤ \ ' $p `0%R&+ ߿ '(F <lF $!@ F }0%%F u!!<l<`@8 ll߿8p8@! <%@HP!C p<"0!8% pp߿88\ % <(%ԡԠF4AF6NaN!8$*@$8׸׶׺f ״0'98 % 0(%߿8߼0߰ ߱('p0'9MP % T(%08<'8%$BР< "! @%F.@F/8$*`%l%@%XP H @ 80( F/@F.XF/ZPF.R HF/J@ @F.B 8F/90F.1(F/)@ F.!F/F.p&@%XP H @ 80( F/@F.XF/ZPF.R HF/J@ @F.B 8F/90F.1(F/)@ F.!F/F.0'98 0߿߼'0'@ <8$`$B0(%%!"!tx $xT % (%' '@ h %x %@%x 0%$罸 $߿@ ߿@߼($߰8߱0'$!叙ߥ T'4 % <@ۏߥ T %4' <@яߥ T %4' <@Ǐעߦ F `סF `dנF h ߿@߼(%߰8߱0'<'$!@!!$x  %hd`FFaxF!D(@ %D'$ D&ߢ߾ ߿߼$߾'`'(ׅ鐌@Dļhľ`F֡ ĸdF!F%ւ׀hFF:\F!0F %F PF "IF<փPl H@84<6mlPF-AF, ׈`׋hׅ鐏PF(2ׄpF:Z߿HF AקEF>ZBF AצF 9F 1N;9F%JBM:aF,[N0N29N:F'F&F#ZF EN!F"R*MD6Mvա HMa"@M`6(M!! +8,0N:<(״@M 29<׶8߱P\"LPp8X<!!a!H I&slm86@4߰0F-AF,% ׈`׊F(2קצE߿HF AF AF 9F 1N8׋hN09N5F:ZF#XF>ZBF6ZׅpF'BN:9F!LaF& M`!F$BM!9F*JB(M:a!HLhС$@Ma (Ldա" N:+860j(״@M 29׶8߱Ph߳X߰0׸ ׺%׼׾('p $`@b8BBPaPAAX@%pH $`F"0>F$(QF F#@F"'PF MF D% D' D'Hx, $ƾ ߿   !#($q!,߱U!0߰ߵ'@(0$,߰߱ߵ'@70!0C&#"#a!&#C##"#70!#0C&#f!C##!CF!!#C#'p(P0<8$B  "!߼8'ߥ(ߣ0LDpDh'@Fs' Fkaߩ ߨߥ0ߦ(ߤ($ߧ0#P (#߿@߼8'$0D@D0,(FB!'F1D8D <F((<$!F9F!!!!׀`EF'+F%CF%9E",D8F9F&9>%EF$0>(D@FB!F(J>E 0DXFZF*[>F%:>E F(Q>E F)[>E EE $$Ԡ8ԡ@'<F/A'pF.?!Ma0M!'9Y@ l8߿߼'@'Ԡ8<'ԡ@?!0F/@'9YF.@ l8߿߼'0(' <$$B,%%%#(%%0)"!#j00'9Y(% l4 ($0!(!@!4 8!߼(߰߱ ߿0߲߳ߴ'@% %% %(%0%8%04 @%ݏ0<D $B"!F!!&` F$i%F$1p$"*xA@ 8ߢ8h^*p@xLHPxHpL#,p3h(00h'@%H''Ďl p@%@&̎ (-$Ď p WnX!MP!,H! PCDp*H#@ %Dh'*'(Fs% Fka!4 u@ % %+(܎)$*((%& @ %$% ߷x(pDp@ %Dh'*'(߷xFs%߶ Fkaߵp*(Dl$ P%x(%ߤ0 o` %߿h|xߤ0\ ߾(ߤ08%0% x߿h߼X߰H߱@߲`ߴP'*(%߫8(P% %l o`%k߿h߼X߰H߱@߲`ߴP'P'@%''l p(%P'$' 'ߥ8l pH%px߿h * aԏH:L߷x߶ߤ0܏H)$*(% ((tl#j#(9!!#Dp@ %Dh'*'(Fs% Fka@ % %܇*@ %+(%%(&$ kH! 3H!܏̏ aX!*P% Վ p$a!j#߳߿h'@H0<8$B "!%(%%4 %@%߿(@M@% 0%*'h0 %* !$ @%@ % 0% `2 ! ߥߤȎ`d ! (! ` h`3H! h ߲@ߢ*߲@ !@*H!0*`@!HH* !H0'9l@ %(%  ߳H߼8߿(߰ ߱ߴ0'p߼8߰ ߲߱@߳Hߴ0'ph'(0$A(%(*%  <1*8$c4 #!߼8߰0߱(߲ 'pߤ@ # D #@ % 0% `ߤߦ`$ !(! $ `ߢhߡ`@#%hG 'E%*`(#$8*E (%QF8*&)0#$@*F 0%I8*@ H E%*#$c q8*CQH%8*@#%* HH0'9lߤ  (%߼8߿@߰0߱(߲ 'p< '%)F M()!F %TDpD0#l q0(#߿D߼'0F!<'%(!ׄF"F#AF$F$@F$F$F ͌(F  %XF MDpF DD0#lD q(#߿߼'0Ԡ8ԡ@'<F/A'F.?!Ma0M!'9l@  8߿߼'@'Ԡ8<'ԡ@?!0F/@'9lF.@  8߿߼'04'p(H0<X$BP8"!@%P%%  %$e@H%q$ i y$s$@.@ %`(% l 0%@t"@ߤhH* ߼X$߼X߰H߿P߱8%߲0߳@'t@ %(% 0%@ %@%x'p`0% $P߼X߰H߿P߱8$߲0߳@'$'&p  %$ ,$I*n׃`ׁׂF#E$@$' <עF D $ 0ߤ k'}@0%%'x!<$BP% "!%߼߷'pH ߤ'$' ''D''(' ߥ ߤl$ $ 8%ߥ0% @%' %0% %߫$%'ߡ`O% (ߵ߳!ߡa!&s$ K&s''0&  0% %'00% %%$߬ߡ%+ߣ`߰HH %(%& `0%QX%C@b ''0 0%&@ @% %'00% %*<%$ %0%ߥ %%ߵ(߰߳  %߲'0%߶% ߱D % ߾߿߼%ߴ߷'p' x!<$B "!%߼'H ߤ'$' ''D''(' ߥ '؏ '0'0ߤ 0%ߤߥlߦ8% @% $@߿$߼'x0%ߤ $߿%߼'x!DF!F-'Ȍx<!$B%% "!߼߰߱'Ptߢ %M %%xߦЏD''$% D&' %0% %ߨ)ߡ(߿ ߴ& %!$3& %`M %%&sBx'D'%$ D& %'0% %&Rt %߿ߴ ߲߳߼߰߱ߵ߶߷'P'$ % % '$i<"4($cI(!!&$ ׁ$H!BF$@ׁ80%;ׂ$m=׃$p$@%x'0%ߤ $߿$߰ 'P߿<(88!48$ $(!!&$ $܏ߢ߰ 'P@%Ǐ$F!ݐ$F"ؐ$F#Ӑ<'$ƀ0&!$x%$ x$ @U@%p %(% F'x'௨$ƀ 4܏l'' D$' 8% %8%'  @%@G@%\$(% $ %\@%@H%@ %(% $0%Y &P@(%@P%@ % xߦD@% % @(%3߲菙 8'߫0%`(% X! % `ߤ ߰߿%߼߱' % h߰x %x8%$X $0߿$߼߱'߲' 8߰߿$߼߱' % (߰@@% %xH%'菦 $ư 8'߿$߼߱' % (߰@@% %xH%'菦 $ƐD % @(%' 8߲߿$߼߱''0(< $B}`(%%% "!H  %xxx@ %P%( F,%)$ $߼߿0߰($߱ ߲'p X T P LߦT$'H(%@ %&'8 <@߿0߼߰($߱ ߲'pTߦ@ %(%&'@ <@߿04@ %(%ߨ 0%ߧ'9H%% '$@߿0H  %4'9 % (% (8F߼߿0߰($߱ ߲'p߼߰(%߱ ߲'p< '`P%X$!{$`!!2%hPH@ߦ@TߧPߥH %$8 <@߿h$߼X߰`'x0% $(߿h$߼X߰`'ߦ@TߧP %ߥH$@ <@߿h4'9ߤH (hߥP߿hhP'@%M8 ( %ߡP %' (-@ %@%' ' '߿h%߼X߰`'' < x$BzPp"!H%%%`  %hߪ@(% %|H%ߨ@8%ߧ p$/@$ ߱p߿$߼x߰' PkT@L ߤh  'X@%ߤh  (4'9ߤ`(% (hX߿߼x%߰߱p'L<4䯡P'< L$!y %%!! % D(%߿P ߿T %߿X߰ %  (߰߿߼߱'@ׅׄԣ@׆`Ԣ8ׁ׀F#1>F"0>F$(QF F#@F"'LF MF D% %DH 'L' DHx, $X ߿ @ !#($q!,߱T!0߰ߴ'@(0$,߰߱ߴ'@70!0C&#"#a!&#C##"#70!#0C&#f!C##!CF!!#C#'P@< L$BvHP%% J"! $* !h,`%`#0 ##%*-#b 0(*+`!X0@%`(#8%#`#(*`#A` 8p!Lh!DpDh'"Fs' Fka" ` %8#X 0#߫8ߪ0ߦ(XL ` %"@H%$  @% ߲X߿`߱h߼P߰H߳@'$0D@D0,(FB!'F1D8D < F((<$!u F9F!!!!׀`EF'+F%CF%9E",D8F9F&9>%EF$0>(D@FB!F(J>E 0DXFZF*[>F%:>E F(Q>E F)[>E EE $$Ԡ8ԡ@'< F/A'sF.?!Ma4M!'9@ (h8߿߼'@'Ԡ8< 's`ԡ@?!4F/@'9F.@ (h8߿߼'0' < L$Bs0%(%% "!֍@tր8 % %؏H  %'L' DHx, $ǀ   !D ףDסF!!FF$F"A؎Td`u莆P^ %(% #%4 `@ ߿߼(߱ߴ ߵ$߶0߷'`H8*ڏHD(צЏxF)a'%F&)@צ$$HD'(HD&0)( (  %'0% %@,%lP#r0*F D0x'F1%$``@% D&0 %'0% % %(%@%8%`P%L $%@F! %x0%% $Ȉ 8*P#߼(߲߰߱߳ߴ ߵ߿߶0%߷߾'`xxקרЏ'%kP#$ǨD'@% D&8' %0% %d(%T # %@z߿߼(߱ߴ ߵ$߶0߷'`߼(߱%ߴ ߶0'`߼(߲߰߱߳ߴ ߵ߿߶0$߷߾'`DסFF"AGЏDעD ׁFF!!F#ףLa 9؏ׄDFעDLDפFaF!!+؏DפFaF!!$؏DׄFעLD؏DׂFaפL 9ЏDׄDFסFL$yעLD h %x %8%x%$ $߼(߱ߴ ߿ߵ$߶0߷'` %'(0% %󏈋d< '$!m!!H% +(@%߿߼'0< '$!m!!H% +($߿߼'0'8(p< h($Bm`X%%`"!%x *P 0%`%@H$s$c߰J$߷߰P߿߾߶߱ߵH߲߳@ߪߡ'@ߣxX `ߪ@BPߥ` % Qߦ@%߿* % X(%@ ߵ %' \'@%@߿` %(% <@0%+߿ ߲p߼p߰P߱X߲߳h$ߴ`ߵ'$ vKI4* & %&1 ` %@%(B@4*rW"` %^$uCߪ@` % %@0%` % '@$ v @ߡ ` % %@0%` % '@$u  %@0%` % '@-*W` % %x@0%` % $@ 0` % %@0%` % '@4*  Pߥxߧߦ` % R@%u߿ S %߿@ Hxx` %ߦ@%$Ȍ $ʨ߼p߿߱X$߳hߴ`'ߪ @߫0`ߡ  '(%` %ߢ0ߦ ' 5@ ,C(@߿ߪ(@^߫0`ߡ8 Zߣ` %$  $ȏ $`44P S@%@8%I` %%$Ƴ ,߭ h+   " $$ ` ,ԏ $ \ X T P L H D @ < 8$ +4 0 0%(% , % X *( 8% %􏆀4< "<"߮54$Ƽ0 ( 4` % (%ߧ'9@%& .0$@ ߿!T ߪ#X`S <$߿ߪ@4 (% ̸$`߿߼p ,߰P߱Xߴ`%j߳h''' \ %@@%x'߫& + tx $ %@(% Wu߿ %' \'ߪ0 @]߿xx %$@ \$00S߿` %(% 7Dߦ0,J8@\߿ % W@(%V߿xx` %$x $P߼p߰P߿߱X$߳hߴ`''P%< x($cfPhp%%` $#!@PX ` %D $c(OH$ c)%xxߤX@%$ F $$D p` %߼p߿ %߱P߲h߳x'x@ %x@%$˘F $ʨ߿߼p$߲h߳x'x߱H$D  0%$@ߩ`.(ߣ`!$hߡ`()$! *@ߨ@@'0%(% 0% x@%%8$c*D'  ߦH@$ cߩH-) ߡ`$#xxߤX@%$˰F $ʨ$4'9ߤX`(%$ߦ@ .0&G@%߰ߡ&2!0񏙀4 ,D8$c(.$ s)$$u!$ $v#$ h ߡߥ  ߦ@ߡ:xa#$uߥ0 ߦ@0x$uh $vߥ( ߦ@$x$vߥ8 % ߦ@$c!$ sc$h6$ c)$ sxߦ $@$ sߨ-x$ sߩ $cxxߤX@%$ $$0߰ߤX|i@%`8%e x$0%@%ߤXi|H`8%e x$0@%ߥ ߦ@$ cߨ-Տx$ cߤXi|H`8%e $0@%< '$Ba"!|(%% $$0( 7Ԏ  %߿߰߼'0H%$p%'h%`%`%0(  ` % $D@ %@% $߮ ߭(߬0 H%@%|ߤ8%LP% p$0(%@߿$߰'pߡ $@ߣ$` $@ ߤߡ  $` Dߤ `(%@߿ߤ$ߦ \t,) 8(0  (!DH߿  ߿ߪ@!0! %\0@4\%߰'p ߤ߿ W (%8%֮84(% ̸$\߿\'< $$c_ %#!"$ \'0T߼߰ ߱'@, 0%(*D8 %)@`! 4@%LP# ,H#߿(8 \0c(`% ˤ@@(%' % p8߿(߼߰ ߱'@ ˤ<@(%`%'8%P%X%0%$ < $B]%%%!%"!$$ $ #%$(%$$!Y"b#|P%%,%H .A % ! b@\0c`a߼߲߰߱'P$$$ 08% \t $$߿0<"48%04 ($Ƽ0܎  D߿0\14(%0 $04(%% $`H4 % Ӹ$P߿0$ 8\ X*4B\`0%$" 8\$ `*h$\8%߼߲߰߱'P4(%0 ̸$\߿05\ ($0 cߧ ߦ(y߿0'< $$![0%!! %8% \t $$߿ ߼߰߱'0 % S߿< '$!Z!!@ %$ p%@ $$ D p %߿߼߱ߵ'0 TD % pߵ߿߼߱'0(< '@%$!Y!! kT$߿߼' < '`X$BYh"!P`%%@ s%*c`Gxp $.(XHߦ@@ % X$8$ c@G߿x)$f!$i#$ s @% ߱p'XߦH% ߱p@$anx@ %x@%$Ў $@߼X߿x߰P$߲`߳h'x@ %x@%$ $߼X߿x߰P$߲`߳h'x@ %x@%$` $@߼X߿x߰P$߲`߳h'߼X߰P߱p$߲`߳h'ߦ@@ % X$@%@߿x߼X߰P߱p$߲`߳h'菄$x 3$- 菄$$- 3$8$߿x4'9 2H %4@(%'9p@ %&&f 2߱p߼X߿x߰P߲`߳h''9-  %9, ߥ8@%@߿x0  ߱p@ %`% 4,߿x߼X߰P߱p%߲`߳h'xߦH $x@[߿x*hI߱px@ %x@%$̈ $@߼X߿x߰P$߲`߳h''0 ߦH@A߿x$h?߱px@ %x@%$ $@߼X߿x߰P$߲`߳h''8 ߦH@($hQ߱px@ %x@%$؎ $@߼X߿x߰P$߲`߳h'4'9 2Hߤ84@(%'9p@ %& 2&f߼X߿x߰P߲`߳h'$- dߥ8 $8@%@߿x0 4  4'90 2 % 4 %4ߤ88%<߱p ($(%ߤ8  0% Uߤ8  %f߿x$- dߥ8 $8@%@ ߿x߼X߰P߱p%߲`߳h'0 '@'  '@ %0%߱p `%xF!'$ D&@ %'0% `%'H '@ %'0% `%xFa'$ D&@ %'0% `%41hx' $@ %'0% `%41b@ %$xF'$( D&@ %'0% `%41Xx'  $H@ %'0% `%41R@ %(xF'$h D&@ %'0% `% x,@0%@ %x8%`% $͐0$H>߿x$ IC@ %! *@ %'P8%F, `%߿x  @(%A4߼X߰P߱p%߲`߳h'@ %x0%`% $4x0%`% $84@ %x0%`% $X4x0%`% $̀@ %x0%`% $͠߿xx0%`% $͸߿x'%$- h'(%( $8@%@H%+߿ $8 @4@0@@ @ @@@P$G,ߪ4ǀ`@$@%@(@@%<@ %@8%@$ ܭB | % 0%  $3pߢ ߿߱(߰" ߱(߰'@'%% ߿%tx $8eߵ`߳'0߳'0a'%$- 0' `(%@(%߿  $ 4@@ߧ ߨH@%< @ %@8%$ ܌D߿S `%߳'@'0!% %x %x@% $ΐ, $h߿ $ߴߵ'( 08H@XP%%$r$y %'`0% %@4 %&& @$ @&1 *I&R - % %-$a$b@%$h%$ i - %3$wZ$x$y %'`0% %@*4̎- %'``0% %@$b- %x`0%% $@$h܎- %'`0% %@n$ i ֎- %'`0% %@ۏΎ- %x`0%% $h@c.i-$w %x`0%% $x@.i-$w %'`0% %@S.i-$w %'`0% %@d$w- %'`0% %@F--xxx %P%0%x%)%ϸ$ψ $$߳(߰0߾8߲@߶H߷P@3߱XF0`߿ ߢߴߵ'x %@%x0%$ $ΰ$*A )$4h$M4 ;*A ]莃4$h$B4*I "$4#$:4߳(߰0߾8߲@߶H4߷P'9߱X 2 AT4 %& @0% @$44c44 %&@0% @$ 454b-8@H( P0X  %&, %@$ $% $im@%$o'x`0%$ %@$뮈0 %@(% '@נF 4(5)߮4 % X$%@@% P(%0! /x E x 4p4EY4'90 2 %4'9 2 %AT %&& @$84@(%4F ̸$<߿  %xH%,$@, $0$# *A 莃4$h$4-'h`0%$ %@6$ i $o'p`0%$ %@$o.a $ou0 %@(% '@@ס44c4F `i$   %4x %x@%$& $$$ $.c`$ i$H0 - %x@%$P, $0$ %' %@עF 0$ .a ?- %' %@ףF $$'0H8( < $$cF%#!"$ì@מטל`$h%(*h (H%!H  `0%8%@%  `%00%EDh!@ -# `#D0fX!D(FP!D8F1D F)`F9FF! L F9F9F!!F FF'P1#`%&$ !!0 $ 08@HPX`0J(߫$ߡ0C|h! X&3$a߫Gߣ(`ߡ$!ߣߪkX!$cjz&&&`%` @ %%@ T%%߲ @&sA1$ D@߫h&R@$Cq$DTߥ ߦ @$߫X`%BA$C$ J%$@%x$*,J $cЈ@C!C` ߪ1j8%ߪ2(!ߤ(J!(!  !AJ $$BX@%`@0%% %́KJC A KJC$ $B A߼߶߷x߲߱*߾8 ! %߱߿Hߵ߳!ߵߴPr%߲@߳p'xߤ`@%'ߦ $p߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8' Sjۏd' 0% "&'&`xA&&& &9j&,& &/"$' @&"&C`x& @&&&@%ߥ`8% A @%߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'4ߤ`'9ߥ 8ߦ0߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'ߤX$P [̏ i&ߤX$P&& [̏  s&&ߤX$P [̎&ߪ Cj!c``v@%xߤ` $H߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'xX%'xߤ`'%؏ $и߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'xxX%'xߤ`%$ $߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'xߤ`@%'ߦ $p߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'xߤ`@%'ߦ $߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8'xߤ`@%'ߦ $X߼߲߰߱@߳pߴPߵ߿H߶$߷x߾8''@hxX@(08%$ %$|ߤX$B3Q &1>%DC~ &RD @*H $!菅x %0%$Ѡ `%p|ߢ P'&3`0B&(H&<&(ߦX|ߡP$B3A0 %q %$ %0% `%$$D$Q,\&$0 %''@% `%  #($`ޏ|&R3 D# &R; %@(%0% `%&RT* 2*@ %(%0% `%  %x@%`%ߧ` $ˎ %'8% `%Î ''  %'x8%`% $ '' D& %'x8%`% $ߨHߡP$߰0߱8߲h߳ߴߵ߿x߶p߷@߾(' $ %x0%`% $ߨP%lP'< ($B2( %%%% i"!`!0 " | x t l h$$pT׀ׁ` `!X&'8(%@ % <`׀F,F%"<׀F(F%!<׀F$F% 'F>)E F4(<ׂEF"F")>E$%$Fׁh@p$Dh 8%0%&8߲ DFka߼߿߰߱״p'Ў(%F pDF!F <$F*8xhP$h , 0%h$ 0%F  ,$`߿F6<@%߲ F-$ߦx 8%׭h&8 D߲F6<߿F!߼߰߱״pF ׶P'xahP$h , 0%F צקH@ (0$' 0%% ,8ׁ`F!)<߿$@H(ׂ߲F%! #"E2 $h  0%$Cm߿@߼߰ ߱״׶%׸׺'p@0F 0ס׀hF!>EB  0%$ Ԏh$H%߿@߼߰ ߱״׶%׸׺'p&' < 0%$A ߿@߼߰ ߱״׶%׸׺'p&' < 0%$C߿@4װׯF Æ'9`F FX B$F @0߿@߼߰ ߱״׶%׸׺'p 0%& <&$A߿@߼߰ ߱״׶%׸׺'p h$ 0% $`$G߿@߼߰ ߱״׶%׸׺'p׮4ׯװ'9F `F F B$X@߿@װ4ׯ׮'9 `F FX BlF @߿@׮4ׯװ'9 F `F F BlX@߿@ףׂhF#EF$*>E F *F*>4F$P>E '9 E%F 3FF ;8F K BF C@߿8״ $'%״ '״ '0(4F KF 3F'9 F ;8 BF Cשרקצץ(פ0@߿8$״ 'F/a׊hMF2׀`F qF PF&)@F4)׶'@%-$F4-F4>״׶'@q'< $!0!!t%%%@ % %t@ % % PX`F!)@F!(EF n߼F ׸׼'0, F<F<Bׁ`F%F!1<߿׸F%EׁF<(׃F#F#2>F)QF!BF& >F-!Q߼F (׼'0X%1@< '% $c #!11 %߼ '`A0!  %߼ '`ߥ`` %4$a(@%( X$(@ߩ8%($-  %5@ NX(߿($ߥ` %($ x(@߿($ߤ 'ߦߣߣxm $!8%ߤ NX$ߤ I$߿(ߢ߼ '`ߤ IF FߦF F < '$!@!! $߿߼' < '$!!! ߿߼' '`@80!%0% %xJIHX%G (%$ @ % 1ׂ`@F"2EX4H 0&s. I %80F%>EF F4*EF F4*"!$*`.%!!$!8!'8*&߱D*@(cDd#C*`"  % N /(!(CE(#E8*V߿ ߰8!߱G8*߼$L߲߼߰$߲߱'P߼߲߰߱'P߼%߲߰'PD* )c!d!C!B*@!߲$8*$%!@$#!*   % N /(!(CE(#%*@'߿ 8!'8*߼߰$߲߱'P߼߰%߲߱'P߼߰߱'P'P߼߰$߲߱'P߼߰$߲߱'P߼߰$߲߱'P< ' $!!! I%08F!)<$F!<$(%&F!RF!(<$0@E&`+F" R$ $ߣ4` 쏙 % I$ߡ ߿(@߿߼߰' &T' D&(8$'4c |$($ F%2E ߿߼߰'< 'D0$B`H!"!P!F1 &ׅ`cDh#j#i#D F!!F% >E/(!(C(!(!DF!F04F$F%<׏hԍ0F(QԎ8F%y@@8' < ($c@%#!"!DL %'( D'D"! @!  C!(!@"00!0c!#!@@@!L(!0!  (!L  ߿(߼ ߰'@ ('' ۏ@ oP<& & H%$ mpP 4$' mP@ ,' kPC !!(!0!0!'(%< ($c%% g#! %@(%8% R&@߿(߼$߰ ߱'`0 $p44ߥE@H%P@%@8%J %%d0$Xp 𨌥,D@l@h@d@X@P@L$ MH@D$ LT@@@<@\@8@4@0@,@($ K$@ @@@Ю@@`'X XB ԏ|@0%D X $A<"4@8%4D $b04 %@(%ߦ'9[@%&' V$D߲0@߿(߱߼,%߰ '`x %x@%$『& $`߿(߼$߰ ߱'` S߲0߿(߼$߰ ߱'`'0< ($B( %% >"!8 $ c@%*D @% !߱8xߦ`%߱8` $$@ߩߨ-ߣ!`$hN4@ %ߦ'9[$&ߥ V$߿0߼ ߰(߲'`x@ %x@%$ $߿0߼ $߰(߲'`x@ %x@%$㘎 $`߿0߼ $߰(߲'`'` @0%$ c@ߨ-ߩ$!1߱8x@ %x@%$㰎 $`߿0߼ $߰(߲'`ߥ@ %|H%8% x$>߿0߼ ߰(߲'`ߥ@ %H%|@%8% x$>߿0߼ ߰(߲'`ߥ@ %|H%8% $>߿0߼ ߰(߲'`< '$!!!@% oP`h4@%$a ܘ$d\  (|8%(% $>  %߿߰߼'0'%h%P%% %80h@%$a4 (% % ( ܘ$dߪ(߭0ߢ8  %H%|@%@8% p$>@߿ $߰߱'p  $$ % (% x$@X%@(%@0 % ߤ $D@ % ߥ` %4@%$a X$d@ @%Ď Ԯ (` 4'9] W` %߿ %߰߱'p(8 %$ |܏`< '`$!!!(xp% k4<8B'$@  \  (ߢ,4'` k\<``@$4'9^ W %@ ߿xA0! l0c`߼߰p'70!0C<`$* @4(% ̸$`l߿x4l'80H@%` oP%H$ ( %($D@  )@% 7!!@E#@ < +r#@ % oP%2!CX''H%`8%4 mp%@`<*C0!(!0!(!0!`(!H%H# H%H! H& @**r!L  P߲ ߳(ߴ0ߵ@ (%  ߷H߿߰߱8߶'`(!!h!#!! a!C@S!Cl' < $$cp(%#!"$ Ol&0K*D)@% %$X%@%0 8% PL@''< (% @T`D\$ %P% o`$$$A߿0 *D( %)@`!%@%LP# ,H#߿0( l0c`% ˤ0@(%' % p(߿0߼߰(߱ 'P߼߰(߱ 'P ˤ,@(%`%'P%@%X%H%$ < $B%%%""!$$ #$ $"6%?@@%-# % .& %F B l0B@I߼߲߰߱'@$`$1l0! 4(% $`H H4 % Ӹ$[ ߿ $l ( X*4Bl`H%$" (l$ `*f$lP%߼߲߰߱'@ ܎ D߿ 4(% ̸$`l߿ 4l< '8%$!!!߼'  % S߿H%1@< '1$B "!`18%߼'`$ߥ$  % xߤ'hB0   ߤߥ$D ߦߥ@ % 4'9^ Wߤߧߢ߿ 0! Bl0B@%߼'`ߤߥ8 $ |ߥ`4ߤ$a@% X$d߿ 4ߥ ̸$`߿l4l߿ '(%< ($c%% #! %@(%8% R&@߿(߼$߰ ߱'`0 $48ߥE@H%P@%@8%J %%$h 𨌥,D@@@@@@@@@@$ K@@@|@x@t@p@l@hKd@`@\@X@T@P@L@H@D@@@<@8@4@0@,@(K$@ @@Ю@@'Ƹ XB ԏ|@0%D X $E0<"8@8%4D $Ə`$ @@%8$$D d$8 %@(%ߦ'9 @%&' `$D߲0@߿(߱߼,%߰ '`x %x@%$0& $߿(߼$߰ ߱'` S߲0߿(߼$߰ ߱'`'`%X%%h%p%< ($P%%%%%%%%`e$!@  %$ $a菓@%$ b $ c $d.$gL$ i c$ n $sYX%`'@0%$` `%@$sX%`x@0%`%$` $@$sI% 'H@0%$` `%@$x$ yH%*A߰xxxxX%x%J`%)@ߤ%$؎& $ȏDߤ p߰߿߲߱߳ߴߵ߶߷$߾߼'@x %x@%$H& $߼߲߱߳ߴߵ߿߶$߷߾'@.HX%$ .I %$'p$@0%`%` ߰@xߪ$Pߣ$tߤ 0%'|ߥ ʀ'p$H!$ I<P+ߥTD߰x8'90 eLߤ%.% DD pߤߢ߼߲߱߳ߴߵ߿߶߷߾'@ߨ$  l߰xxߤ@%$阎& $Dߨ$/߰ߩ$ *+xxߤ@%$& $vDߨ$  k߰xߤ@%'P& $hDx@0%$`$` `%@$ bߨ$  &߰xxߤ@%$p& $PD'@0%$` `%@ $ cߨ$  )߰xxߤ@%$舎& $:D'@0%$` `%@5$c$dx@0%`%$` $@7$c$dx@0%`%$` $@$d.Hߩ$ *"߰xxߤ@%$؎& $D'@0%$` `%@$gߨ)n߰ߩ)) j8ߥ&@'08%&ߤ d%@ߣ$hߤ߰04'@0%$` `%@$ iߪ$T߰ߣ$hxxߤ@%$8& $ՏD'@0%$` `%@$i$ n'@0%$` `%@$ n.I ߪ)J@߰xxߤ@%$`& $D'@0%$` `%@y$sߨ$  ߰xxߤ@%$鈎& $D'@0%$` `%@$smX%.HjX%h$ 'X@0%$` `%@v$ yߨ4Hߩ$s@h!%c!0c#ߩ$4ߤ 0%'lߥ ʀ'`$ J$CHߣP\Tp߰8'9ߤ ep@(%ߨH%ߩ%-( ߪ@Yߣ`XDD8ߥ&@'X8%& ߤ d%@Jߣ$hߤ߰X\CD $!0$ a ]@%$cc$ij$ sH%*߰x@%x 0%$ߤ $(D% 'Lߤ l%@ Dߤ'P% l%@߰!&$mR$ d&x@%x 0%$ߤ $Dߦߤ،' ZD.Hߩ$ *߰xxߤ@%$討& $D.Hߩ$ *߰xxߤ@%$P& $ݏDߡ! ߰ߥ`DDFFaF"Cp`dD0!DFFF#׀hF"<ߤF D&'h D'.I #ߪ$Tk߰xxߤ@%$& $D8ߤߥ'9@'x&8% d߰@+8'90ߤ eLx%$߰xxߤ@%$& $Dd|%*H`P))EP!(!@@%@ ߰I( ˯x߰DנpFׂL@F ߰Dxߥ|`(!xߥ'48%& d%@+߰ߩ ^D8ߤ'94 c$0D8ߥ&@'88%&ߤ d%@Jߣ$hˏ8߱@`%@H*߰ ` 1@Uh%$ %$dbO!$!K %8ߤ&% f0%8ߤ'9@ߥ'8% d&@%Dߤ% f0%w߰8ߤ'9@ߥ'8% d&@߱Y1$% %$dbR!$!N %ߤ'H l%@D8'9ߤ e쏥Hߤ@0%' LDߩ'`D( % DߪTB<l*`?%&%&Rߤ 4%<@*13߰ߡ!p +߰ߥxD0D(F1F)aF&)C`xpD80!D0F9F1F'1ׄhF&!<ߤF$1D&('h D' ^ߪ %ߡ!`@* ߣc*` ߨ dh!H! @!@*Dߤ\#C,H4'x!A#!8 kx!xߤ؎(`8%@0% $珙Dߤ؎%'h l߰@+@߿h %t8'9( epߨߥ'\8%& d%+*߰$߰ߤߥ|H%(8% $A8ߤ'9@ߥ'@$ d&@TDߤ؏@' D8ߤ'9@ߥ'T8% d&@AߦT`+`#d@ @*􏙀8'90ߤ eL`(%D %'@@0%`%` ߰@ޏ8!cpDע`Fa׀L!F ߰D %@0%'$` `%@ۏ8!߲Itil@ % CRx H)2H!߰C!( ߲lCthRxC!.I ߪ$C߰ߨ$  w8ߦ'9 ߤ$&'ߥ `$9 %' @0%` `%@r$c! %'(@0%` `%@$i! %x@0%`%` $P@mߨ! %@0%'$` `%@ߨ!&8$/'90(!(Cߤ eLe(#Dߨ'`Kߪ&)I8ߤ'9@ߥ'D$ d&@D8ߦ'9ߤ&' D bh$ꏙD&`!l`#%叙Dl*`B􏙀8'90ߤ eL(!ُDߤߥ'<8%& d%@t߰,8ߤߥ|H%(8% x$AߨO߰xxߤ@%$0& $YD/߰xxߤ@%$`& $LDߤ'9\$ fXD8$/'90(!(Cߤ eLe(#Dߤ'9`P eLD xL `P Xߡ@!$$db!$! "ߨ،# `ߩ'0p(ߣXljߥH%|ߤ@%8% x$A`8ߤ\'9X8% f߰WDߨ'8R߱1% %1 &R# `''@0% %'ߤ 4%&s߰ߨ6Dtx $0D'< $!%!!  %  %@@(%߿߲ @  (߿P  (%|8%(% $A %  %߱߿߰߼'@'H%X%`%|h%P%@%8%k p$A@߿$'PߤČ Ԍߤ( 0! 4ߡ 8@ 8ߤ̏8$8% $ƛ0ߤ8'9 `H߿%'P(%⬀('ph<< p$B!"!(`% k8D<x'<4@  @@%  (@@L( k8<'$@  P@%  (8$'9$$ % aP߱x8(%'9 %$4! f߿h߰`߼p''@X$C$P< 0A`%$c #!8'9 f %߿0A 8'9 g< %߿$A$`Dc0c`@hgDf@De lhpxjDi@@%X%@%8%@(%$ ` % p4H x``#!@&7!d)1! @1#&,* 8h%d! %ð!&%`*@k i߼`߰P߳X'88X%P%H%@%B(% m<W R@P&1*`Nߵ`$`*$# \JM 4@@%0!D PX%i@@%8%(%$` %B`!0,H# Hߡ@ ߣ8`B@gL d,' &W k8I 4H(%@%Bx#!!ߦ05!#8X%# lP%10c`ߦ0ߵ߾߲h߷p߶x߱ jD((%` %i@`! $@%LP# ,H# ( 1!(% ˤ0@(%` %8% p(kDj@@f4 H%@% (%H(% |߿ߴ߼`߰P߳X'(% ˤ,@(%D H\$ ߬HX%ߩ@(%@!8#,H!߬8` %  @# ,H!, \` %(%$  H@%D$ <8%ߡ8 q \X%@%ߧH(%` % HD$ 8! <8#VdB HD$ ` %(%ߩH$ @%ߧ@$ $߬8H!8# ,H!NB' %%%80%(048$'8(8 m%p %t * @ %p  &8 m%p,8ߴ0' kߵ8TH 4 !t8!$ \p"!&1"@H$)(0( Q0XJP!((!(!0  0!4  @%߾  ߿( l ߾ \ (%\0% t߿(߰߱ߴ0'`$(aa `߱߰ ߴ0߿(('p( %* &B@*H ߱1X@80ߡߣ!p(`C @%h`PHߵ4%!#C2&@% %@%$D %ȬS@%$T % ߤF(%%& m8@Bߨp@*ߩ"p ܮ@ ߪCCڭRߵ(߶0߰8߾@߿HߴP߷X߳`߲߬hp ߪ#`ߪߨߪB߱ߨRH*`!L ߱ ߣC!ߢB`ߣB@*C!ߨ`ߢBR@*ߪ ߩߨH@! *`(%Iߨߣ4B#ߨH4C8'9(%0%Hߤ a8%8ߦ %'9@(% f$߿H߲'߱j1$ %$db!$! % %\X X%'(% *' #+% * @$&@%$db!$! % %H@80((H0@%8%$@'D`C p&18&, P$cP %3 ߿P@߲ ߵ(߳8߱@d7@* #ߴH$(#>8#$@*`7@*ߧ>#$!7*@`%`*@;`8*"7*>@#%88%0%'9(% %5) a%@߰0߰04c8'9 %(% f$߿P߶߷߾'@⏙8*`ޮ$ڮ߶߷߾'H@80(v%Ů`%'$ < $c%w#!$$ $ $G5$/F,8(% %'9 $ $ @$ f߿  l  ` ܎  D߿ 0c` 8(% $PH4 % Ӹ$0߿ ߼߰'@F$8(%'9 % $5 f߿ 4cD\ !d#8'90`4$#* h % eLd8'9 % epx8'9 %(% f$߿ 8'9@(% E e %ߦ8 '9 % e(!8'9@0% % fߥ߿ '< $B0%"! %l`` %ߤ S߿߼߰'0'``@(HX0%%8%%P%%  %0$a@%q|$e$ @ B@ % (%0% l߰`@ h@ %$`%ߪ @xx߱0߲@߳8߿Pߡߤߵ( H* %x@ %@%x 0%$ $p߱0߲@߳8߿PߴX$ߵ(߶H'DH* $@߶H%ߴX'd'&30%` %߰` %g$$,AD@@%d'0%$ ` %g$`8$H% 8'9ߤ e@(%'x % @0%@$aߡ,! ߢ߰`B %'  ߦ@$eߣ,c`{$eߢ߰`B %'ǀ ߦ@q$ @ߢ߰`B% %'%d #*( `8%(8 '0 `4߰' 8(% ̸$P߿4H4!@c!pB!##"#@#%0*@ t)@ x@#'(@' 8x'9(%4B fଂ߿'%(#% \ ! @d 4B@HAP#8!G#t(!pE#HD# @#D!H*`B# &R@@% #8'90 % eL(%!#88!8@(#E* @(%߲8'9 % ep߱߿߰'@߲(%@%ٮ4\#fhd"!$"a*A `(g C!$#A*a $'@%'0*%'@€ 8%*%  TH*$%%+(-$b( $$CA$bap% p N# 8%x% $8'*%!x % %@X%hH&@% %@(% b( `%A! h *x%덭8'9 %(%H f@0%߿Hߢ(@߰0#` ߰0) ̏8 8%$H$ $ƛ0߿H߰0߱8߲@'p߰0߱8߲@'p'< $B@% C"!' 4%߱1 ߿ &%'& <`%$1 ߿!  $'Lj' <`%&%߳%ߵ@ PP#@ ߧ@%0*(! ߤ  0%ߨ(@!' 8߿߰ %߱߼'@$߼߰'@߼$߰߱'@< '$B~ "! 8'9(%8% f%&߿߼'  'Ќ0! 0B@'08ߥ ̸$P߿4߿'0׆h'phׅ` 3%$3DF!"`#db!D F!!F !D(F)aF$0@"!/$ I$$$ f ߣaDb$F$ b wlߤ߿߼'0$ 䏙 wlߤ߿CߢFDA4!A wlߤ߿ y@ߤߢB@ߣc0c`ߥ 䏄䏙ߥ`8% Hߤ Ӹ$߿߼ xߤ wlߤ߿ߦ܌  Dߣ< '8%$!<!!߼'  % S߿< '$!!$'(8%'$`%'9 % % }t%@ $ 9(@78$'9$'0  8%$A 0߼߰߿߱%߷߾'$i$C8(!$* !`#* `#A`  ߬n* *@߼߰߿߱%߷߾'xxߤ@%$hߦ $P߼߰߿߱$߷߾'ߧ|ߦ %(! ,0!ߥ$ $8$   8$'9$'0  8%$$;H:0)8$!I$,i񏙀88$ '9$'0  8%$ AߣЏx$Bb ߼߰߿߱$߷߾'8$ $lߤЏ($8ߢߡȯ 1@;@/ߨ'9'8%  0% ~`@ڏ $ lp( @08ߵ%%ߢ&9t!P%&%/@%,.P*&RP*`&1! R*@$ `@P%P *#`%JP *&1,J@#8%p0!' % hh! |P*R*ߵ@ߴ8߳ ߶0߲(ߤد ߼߰߿߱%߷߾'xߤ@%'hߦ $(߼߰߿߱$߷߾'''9 %1'$ }(@(x0%ߤ $߼߰߿߱$߷߾'8$'9$'0  8%$AߣЏx$BDb %ߩ@%0%ߧ |'8'9 %' }0A8ߢЏx$!.A8 %''9$18! }(@18x0%ߤ $'8< 0'%?!8'9 0 ' (8''9 @$$ '$ A߿8%߼0'`$' 'p@$' 'x@߿8" %ߥ(߿8d%ߤ $߼0'`'@H0P< @'$X?!8`8'9 0h% %p ' ߫PߪXߩ`ߨhߧp$ߡH8į x'9'  %$0 {߿0߼@߾8''88%'9 $$ '$A߿ %'P$''` $@$''` $@߿ 8'9$$' ߧ$A߿ %'P" %ߨ߿ d%ߤ$'P' (8%0$%8 %&$$'`8% %@&!P߰ ߱0߳8߿ߴ$ߵ(߶'`߰ ߱0߳8߿ߴ%ߵ(߶'`$'%$%$$8'9 % ~<$/P@8߿߰'@8'9 % ~<$/P@8߿߰'@8'9 % ~<$/P@$!/P!0!$c/P cߧ8'9 % ~<$/P@8߿߰'@߿$߰'@'Џ8$'98%$ '@,A@ 8'9ߤ@(%$ ߧ@߿'0߿$'0߿$'0' @xpXP`@%`%%%%%8 %8%H$'9h%$ '@(8' $ % H%߭ @߬$Al!````h% %(% H%$ $ @H!0ߣ@8d!ߡ0^h*߬A* h*ߡh!`ߡ `*s@##,#$!-s@#&RS8#(*ߣ88`E%`Aj?kf& $ l`& (*8%-0#! 8'9  %(% H$ $ Aߤ߰X߱P߲߳ߴpߵH߿h߶x%߷`߾('$(*8 $BF$GH$(*(*S!h#` ``!&&(*8߰X߱P߲߳ߴpߵH߿h߶x%߷`߾('߰ ( %@0%x %8% $@߰X߱P߲߳ߴp߿hߵH$߶x߷`'&߰X߱P߲߳ߴpߵH߶x߷`߿hx$߾('%`'%8%0$" ($8$(%0!!'9P` %$?$! ߿ % %2&/P߰(` %$BAAA cA@@`$! 8%@H%`m(lM$!$$ $$!B'A$$ %+ & "A  !A $A #A &A %A$%j `$$gA$$`$$(A$`bA` aA `dA`cA`fA`eAABA$%I @$$GA$$@$$hA$@BA@ AA @DA@CA@FA@EA$%+ $$'A$$ $$HA$(A%A &A #A $A !A  "A %p*$ (M #߳80ߵ0D0!300!(t! ߵ0a !$c `&`%($A@@$A @@ @@@@$" #1       A$A @C@@@@@@ @A%ߴ'p%P@8 &RP` %0% @% ߿ ߲@߳8'p %@H%`H%%Ph+߳8$B'p@8(&RP` %0% @%0@e@%80&/P&1f1` %߰(߲߱@߿ ߳8$ߴߵ0'p߰(h&/P`*0% % $p*%$@%xx! 8%$!$c$AoPU`*@%T!!($aBA 8%@H%bh$h!Ap*  (߭`!%߭h+ ` %0% @%A@%%߰(߲߱@߿ ߳8ߴߵ0'p~2%%`  %$!!!A c"@ `$B@8%`n H%(n$!$$ $$!B'A$$ %+ & "A  !A $A #A &A %A$%j `$$gA$$`$$(A$`bA` aA `dA`cA`fA`eAABA$%I @$$GA$$@$$hA$@BA@ AA @DA@CA@FA@EA$%+ $$'A$$ $$HA$(A%A &A #A $A !A  "A `*%  (O($ #0D(!t!( (!$c !` `@@`%(L %  A$ A  A  A  $! A"  h% A AA&0!ߨ` %@%0%$  ߰(߲߱@߿ ߳8ߴߵ0'p߰(߲߱@߿ ߳8$ߴߵ0'p' ~< %@@%` %' ~< %@` %@% я߰(߲߱@߿ ߳8$ߴߵ0'p߰(߲߱@߿ ߳8 %ߴߵ0'p`H%}@H%% %$N.A $M-A $L,A $O/A $N.A  $M-A $L,A "A @%       9 % %$M-A $L,A $O/A $N.A $M-A  $L,A $O/A "AL @ @A @@A@@A@p@A'% %$ ߳'@j!*$`$1(߳'@&/P<%@%ߴ`%``%$%K O@(* ?EX I& (i#0c(!g&(!g#d%J ?$ O+C$B@(*a%L%K %߳ߴ'@(#<` 4&/P4H!0! 0P< &/P<48!4cg!c0Q8'9 ~<$0R0X'($ $/$c FP#X $%J߿j!'(%%80%$ &s *  % `%U&"&1%߲߰߱0߿ ߳(ߴߵ'`$'%'2% 8$&1 @  %%R߿$(A߱ $$߲ @8%$c$b$@)0EF0Aߢ߰'@߿߰߱ ߲'@$߰'@(% 0%0 (%8'9  % ߿x,{0$B 0!`$%$$$$$$$$$ $ $ $ $ $$$$$$$$$$$$$$$$$$$ $!$"$#$$$%$&$'$($)$*$+$,$-$.$/$0$1$2$3$4$5$6$7$8$9$:$;$<$=$>$?$$$H%X%'P% 8'9 @ %`(% @0%߿'0jP %0 x (%߿'0'(%< ($c %% #! %@(%8% RF@߿(߼$߰ ߲'`0 $ȏ88ߥE@H%P@%@8%J %%5p$ 𨌥,$ " ЏH"@ x t p l$ -h d ` \ X T P L H D @ <$ ,8 4 0 , ( $ $.. $k Į, , ' X+|ԏ| 0%$ X $O<"8 8%4$ $3Џ$  @%8$$$ d$:P8 % (%ߦ'9"@%&G $$߲@߿(߱0߼,%߰ '`x %x@%$؎F $߿(߼$߰ ߲'` S߱0߿(߼$߰ ߲'`'0X`hp< ($B0%%x F"!@ ߤx$ $b@%$c$ d $g$i&$ s ?X%`'p$ @0%@$ s :P%@x@0%$ $@$ x@% 3߰xx` %H%x&%H$߲ $Dߤx߲ p߰߿߱߳$߼'Џx` %x@%$& $߿߼$߱߳'.H$ .I P%$ 'Ȏ$@0% ߰@߲ߡp$ *ߣp$h4` % 0%'Pߥp ʀ'Hߦx$ Ia@$ J$H$ Iߡh0%ߨ`,# 0 ߪx@JH* ߬x%F@߬x8(0 @'9+ %5k 쭋ď8'9; ߤxD pߤx߿ߢX߼߱߳'ߡp$߲#߰x` %x@%$& $Dߨp)߲߰x` %x@%$& $sD'($ @0%@?$cߨp$ ߲ ߰x` %x@%$& $\D'0$ @0%@$c($ dx@0%$ $8@ $ d.Hߩp$߲!߰ߣp$h8` %ߦp'9"$&'ߥx $X'8$ @0%@$gߡp(!߲ ߰ߣp(c`ޏ8'95'ߥx& p` %@ߡp$#B8$G'@$ @0%@$iߨp$ ߲ ߰` %x@%'H& $D'P$ @0%@$i$ s'X$ @0%@$ i $ s'h$ @0%@$ s.A ߣp$߲h߰x` %x@%$& $֏D $+p$c@%$ p ߡp(! 98$a$f$ r .$t%#`߰x` %x@%&$߲ $D` %'$ l% @D+f$m{$ d&(x` %@%x`0%$ $D8'95` %ߥx'@ p&+h'95'(ߥx& p` %@D$a.A .ߣp$߲h8߰x` %x@%$(& $tD.Hwߩp$߲!2߰x` %x@%$h& $bD$`'$@0% ߰@߲ߩp$!5x` %x@%$& $IDx` %x@%$H& $>Dߩx)DעHFa׀L!F Dx@ߣxhi@c)H! @#$!P*H*)P H`&!e@P&H!a@ߡx!|a8'9;'8ߤx '0ף8ע0D''Ўd D&mD` %'̈ @0%@5$ pߡp$߲#߰x` %x@%$& $񏙏D'̐$ @0%@ ߡpߨp$ ߲ ߰x` %x@%$0& $ڏD'95` %ߥx' p& @яE* 2ߨxH|ch.D8'90`ߤx E0#'D'̨$ @0%@$fߡp$߲#߰x` %x@%$H& $D'̰$ @0%@$ rߨp$ ߲ ߰x` %x@%$h& $D'̸$ @0%@$tߨp$ ߲ ߰x` %x@%$& $}D ` %@0%'̀ $@8͎+8'95` %ߥx' p&@gߡx!%PP$P'ߤx' '' pxߦx $8!d 0!Dߥx` %|H%(8% $JX8ߧx'95` %(%& p$@2D8'9; ߤxD ` %@0%'x $@Sߣx+yf8'99`ߤx X(}D.A $ߣp$߲hx߰x` %x@%$x& $Dߨx$e8ߩx'9;1 % 1^Dߣxc'̠$h&'̘ TaߪxJ@ ߬xL0!(&!Ca* $ߡx, 8'99`ߤx X(?Dߣx(:a '98ߤx ($5D$a$h/h(O!H! HC+H* 揙8ߣxj 8'95` %ߥx', p&@(,a* $ߨx8$  $;0ߩx)1@ߣx̬k8,`P%$;0aQ/ߨx8'9; ߤxD8'95` %ߥx' p&@D'` dDߥx` %|H%(8% x$JXߥx` %H%|@%8% x$JX8ߧx$ ̏8ߩx)8 8ߧx$ $;0(8'95` %ߥx' p&@TߣxHc|!#D8ߤx'9.&  D< '$! !!% h8@%$a ܘ$?  (   (%  @ oP|8%(% $J  %߿߰߼'0'h%p%%% %0(h@%$a8 (% % ܘ$?߮ ߭(ߢ0@P%H%@%|8% % 8 p$J@߿$߰߱'p  $ % (% x$@88'92  %'92 % @(%` %8@%$a X$?߿H|Kf@ďx %x@%$ $߱H߿k$ |߰'pĎ, Ԏ`@.'Ž T ! C`*T 1k`8'9>p % $8 ߣ`L0  (!L@80'9%p %8!$ \߿%߰߱'p%L$Ю`$#Ꮩ̏88%$ $;0ڎL< 'pp$!!!4`$h%< m'̘@(b k<D<x'<4@  @%  (t( k<<'$@  @%  (8'9+ % ߱x8'9; %4! ߿h߰`߼p''@H< $$c`P%#!"$ Ď,1,X' k<0M8'9< %$Np$ 4`h('DD&@% l,*D@%X%@%8%J!$)@D#@(%¯@%!!#C0(  % C*` B`*P pߡ(Mh#h*8 * H |clw 1h*vP'$8%' $E pH% $r8! D o`@(%  K* D @(%J#`* o`CP h$ L 0*DL@(% %)@`!,@%LP# ,H# L 1.@(% ˤH@(%߲h %`8% pL+D*@&4 H%@%`(% ߲hH`(% |߿X߳`߼@$!$߰P߱H'߼@߰P߱H'@(% ˤD@(%߲hP' 8%@% pH% ` g`!ߣ(8! `C8#*` 1?P@(% %ߨ0 T$ LP!  @#s ' @(%8%@% pH% CC!P'$8%' H% p$ߨ0 p߮8@(% %$$ 8# @#k`! OP!!LP!8H!l @#.H# ,H!% l͏X%@(% %ߨ0,$ LP!  @#18%' @%( @ %߿(x }(0@ oPH<''d$ 8%@(% mp<D8#g!C@c!A#2#$ ߲0d߱H&@H#8# 8#I!H%CAH  .L@@ % (%8 o0%@%'@(%P@%8%@%H% p`%&@*( E8*ߴ@߱Hߴ@@(%߱H'8%@%H%`% p߲0 3H# ߳8,' k<0!0!`>B!((!  ߿(߰ '`( $@0%#0% %X!x$BHPC@@%)I &`%x%d%!aAx!a$cdAx @%`8% xJ00*( H! W`C(!`%(!xHxG'(0 %% %@%߿ @F@% ! $@%@ % 0% 3 ! ߥߤȎD ! (! Q8*߳0$*@!R!߳0 ! $8*Q@*! "*`R8!Q@*R!8'92 % ߲(߿ ߰߱'`߲߰߱(߳0'`'!E#A* %@W%R #  $@%@ % 0% Ȏ4 !(! (! 2!Q8*ߴ *A*@#R#@%! ! ߴ `2@!@* #8%( (8 D* $ Q8*2!A*R@#!@  "*2@!`H@*R8#(8 Q*2! R8#C* 8'92  %߿߲߰߱'P߲߰߱'P'%%8'9+ %߱4! ď8'9;  %߿߰8$ |@@%D % @⏙8'92 %  (%߿߱߰'0'%%   %$D @ % (% $* D*@$`0*88'9+ %4 ď8'9;  %߿߰߱'0* $$ < '$$B0?"!$ F@#$$ f8'9>p (%߿ 0B@8ߥ $&ߤH8 Ӹ$!߿߼'0$8'9>p $߿ % Dߤ߿8'9; ߡ?7?߿ ߢ8'9+A@ %4! Aď8'9; ߤD pߤ߿< '8%$!!!߼'  % S߿'(0% %% %$e$a$i$ ss@ %|$@,ߨC %(% l@0%@tB@ߤ*`߿ D߿ ߰(%߲߱0'`t %(% 0% %@%x'0% $߿ ߰($߲߱0'`$  d,I x %@0% $@Vx %ߦ $@ُtߨͮH %' l&@Ώt߰DH* %@(#E* %$$L0% oE(# BH@*߿ $II %@0% '@tߡ! A %@0% '@tߣcC %@0% 'h@tߨH@ߩ)I߲0x߿ &Ю0$߰(߱'`'%$ #d!@b(8#* @%$($8%(8߰' '9+ %5 ď8'9;  %߿'Ќ$%&% *@$* % $*$*`$@% (%8'9; % ߿߰߱'0( !@ 򏙀8E߱߰'08`ُ̏88%$ $;0߿'%< $!߰%@!!8`*#"#@*  8% % 0%G(! (!߼߿0@!߰ %߱'@$߼߰'@ꌇ߼%߰߱'@$< '$B& "!8`8'9; ଆ߿߼' ' (%0! 0@' ' 84 ̸$&߿׃`'%%ׂh +%L@(#0%(# o$DDFFaF"CH8*$B C#$,AA D@!DFaF!F!߰߿߷߾'@߰'`x %߱x'@0  %8'9; %' 'נס'D'' D& %8%' %@x % $$  \ %t %(% 0%D p %߰߿߱x''< $BP1%1 ""!X`$80%8$ x$=8'9;  %߿߼߰'080%\5 x$=߼߰'0' %% 䌄$ĎX4 @ď80%\ x$=8'9;  %߿߰߾'0$H%1@< '1$B "!`1 %߼'`$ߥ$  % xD'ߥB  @߿ 8'92ߤ ߥ߿ %߼'`ߤߥ8 $ |ߥ`8ߤ$a@% X$?߿ < ' $!!!|b%(@%Hh@@ @@%wG0 \@ % ` %@X%2q(!߳ P%߱ %` `@Aaa c)%J%k%)`)`0%$L@%) e(%`b$A$!AbA$!AbA$!Ab A$!A$cd@b$A$!AbA$!AbA$!Ab A$!A$c`dьbA$!Aa)%))i(%(h $ $ ߿0PPhߨHG B߼ ߰߱@%߲(߳'P0%0 tbo߿0` %(%($$! )%)Ϭ)< '$! !! ߿߼'0'0(< $B%(! %%  "! \@ %`߿0y @ % ߳(@ ߿0 u߳( ` %P%2#p(!߰@X%߳( %` `@Hah c%J%k$``0%$M@%)c(%`b$A$!AbA$!AbA$!Ab A$!A$cd>b$A$!AbA$!AbA$!Ab A$!A$c`dьbH%Hh$g$!a )%)) $ QQh߿_߿0I B߼ ߲߰߱'`0%tx $Hr` %$!)%))(%( $ҭ< '$c #!h"%8'9Xp  (%ߦߧ@߿ ߼߰'P߼"߰%!'P'< $Bp((!%% !"!h g 08'9Xp % (%@߿0߼߰(߱ '`''ߥ  %@ ߿0߼߰(߱ '`tx0 $x߿0ߦ %(%8% ߿0߼߰(߱ '`%'< 0(!($c`%  H#!h g788(@*H ) !  $@ % (% ߦߧߦߥ %$ ߱ߥߢQX!ߪ jI%)I %% \߿8߼(%߰0߱H'p'9Xp@ %8 (%@߿8ߢ߼(߰0'ptx8@ $ߢ@߿8< '$c #!h%"%߼"H@*I!H!)%߰߱'P8'9Xp   (%ߧ@߿ ߼߰߱'P< '$c0 #!h"%8'9Xp (%ߦ@߿߼߰'@߼߰%!'@'0(0%%H8(!< %$ϰP "$!ߪHhJ K8ߪH`* Jh%+ h %V߬P K#!`*~X*^9@%`  pxߪ@h!j!|  !  %JTp`t%k&s`,  J9 J  ߳߿hߴx߲ߤP8#ߪ@0% #UߵS!@#08*!߶`@J!߷p` @!!* c$B$!`J@ %% < %(`aa$ଁaaaa쬁a謁a䬁aଁ$cba$ଡaaaa쬡a謡a䬡aଡ$cabڌajmlk쬋j謊m䬍lଌ߫PߨP߶`߷p1 ߵ%`I8C߫@ߪ@@%K!  @! -AM-$!$B%@0%%4 %(@%̀$A$!AA$!A$9$A$!AA$!A$̀ጁM%M%kh߫ߪj \ߤH߼ ߿h߰0%߱8߾(''9Xph % ߥH@߿h߼ ߰0߱8߾('0%txh $߿hߤh !  X @%ߦX %0ߥ@ %px߷X!ߵ@|u!! ߵT %  %JTp`t%k&s`,  J9 J  ߰߳ߴx߲8# ߶`0ߧPߤX !ߧ@%( (!߶` !ߪP@M߷pߪߢXߧP@%%08!` 8! +AK+j$!$B%Jj@C@0%4 %) %̀$$A$!AA$!A$($A$!AA$!A$̀ጁ%kM%Mߤ@߬߮߭ +0%ߪ@0%ߨP0J!@!@!߷p*!@߶`` @!AJ c$!$B`*8 %>@(%(`E%̡$ %ଁ $ $e (aaaa aaaa$ ̡$ ڌ z߫P!`(%߷X!5ߵ%M-L,K+J * M-L,K+J*%`%-M,L+K*J-M,L+K*LJ%-M-%+K+j%Jj%-M-%+K+j%JRj'(0 < '$!`!!030%8`%@3!$!& -C@ ߱8߰(߲0 ` % % ߳߿ ߼߱'P @%$c&` $ @%  @%ߦ߿ '0 < ($ &!  @H%c@% P%2%XrX!߲` ` $AD c%)%J$!`@0%)L %^H%`b%d$A$!AbA$!AbA$!Ab A$!A$cd?b$A$!AbA$!AbA$!Ab A$!A$c`dьbD$Dd$!a(%(h $$ % ߲h߼(P߰ Qߧ߿_߿0߱ 'P0%`%A!(%(H($G'$D $ $!׬'P8< H$B 0 "!h߷8$%(% !0+@%<P 68` @A>!! c$B6$&` 0%(@%%p(x``rheb $l$%%0%$  !%(%^!B $dx e!F$%!Cx E !&$%!Cx ?%&(# F$'f $ )%! *&oy"dx e!F$%!Cx E !&$%!Cx %% #F$f $ %! &oV"dx e!F$%!Cx E !&$%!Cx %%# F$f $ %! &o+/"dx e!F$%!Cx E !&$%!#x %%C&$f $ E! &o B X%@%`8%` pߴ@ 0`! @dx t(!V$%X T!s%($!e v$'!( R$$Ԙ! V$s'4! v$'4!Ӑ 1$&Sp!P 6$&r߿p!q p$&Qߴ(N ߳$&.߲`0p `$߰ %߱x̨ p߾ p  %x(X`|(%K%L߲Xx%( % $@%3  %`0% % qX!`b@/LlQ@ @@ KBH%HߦP0#"&R%'' ''ߤH %ߨP@<@%(+ X*`&tx $Ǐ P` % Ռ 0%Я tώb%$  %Q߱xUߵ߲`߷hߴ(߿p߾߳ߨ0߶߫X@% K߹09߱x ߵ ߤ8߿phߢ8߼PA %߰ '߷h߾2%߶߱X߷h߾߶$%k`K&1`CߵߤX߲`߱x߳ ߵ߿p߼߰ %ߴ('$$!&1 2$% `%$ `%hpߤ8 8'@%2߿p%@X%P% `%H%%@`h% %%@ 8%%@%@h%P% %@H%@P% `%&1(%`%CKLA X~!~X! `c`!v$$>!@ !($%$Bk 6$$lvX$a` %D( %'< *$B% t"!'%$uD\%!'P % !& 8@ %`0%P ֈ%D&s !$uDߵߴ߶؏ B@%$߿߶%ߡ$ d %!΀'P % !& 8@ %`0%&P %S(!$ߵߴ߿߶߾߱'߰߷B'x&~S&'x( b `A߼b #S߲߳߾'  %߿  @%߿ 9'% %d (%ߦ߿@   @ %ߡ ߿$߳'@$wbC$4Bf b߳'@% (ߤx@0%8%ߤ $x߿$< $$c #! $$$H"L$8$#<$@$&D%$< '$$c #!L$߼'  H<`8D@ X$$LH@߿( % $@(%߿ X$8$<@߿( % $@(%߿ X$$D@@߿( % $@(%߿< '$!!!%  $ ߼ߧ ߤDG߿(C(߾'P(< 'H%$!!!H%Ef (  %߿߼'0< '$!!!0(6 |L$$"$ % `% 9(% 4!   %'(%x %@%L $8H0㏂@Pp$ %D % (%߳߱߿ ߲(LHD@<84,0߼߰'@'Џ0%' 0@%@߿ $4@ %@% 3(%8ߤ'ߧ $hЏ ߤ@߿%߰'0 $@ $@ $@߿(ߤ $ߥ߿(ߤ $ߥ동(ߤ $ߥꏙ< '($!00!! % 4'8@V@%XPH@`<h&־@ 4 %$$! &$ߤ 4'@*@% P%%  %s@PQ %(%0% % % % %0ُ􏙌D` % (%ӏ߾h߱@߰H߷0ߴP߶`߲߳X 4Lߤߤ %߿ ߼(ߵ8'߷0߳8H<$ @@$(c`8$ D $(B@@$d L$(! H$'< $!!!%0%ߤ 0'@+߿%߼߰'0 4@ %<'9ߤ (%8$'9j %$! $߿$ %,$C*@4B@4F0%߼߰'0Y,@ % @ ߿A 0ӏ%߼߰'0%߼߰'0Dߤ (%@߿$߼߰'0'< $Bp%% %"! 8'9g  %Y0@ %' @% ߿ # pt߼߰߱'@x $߿ 0 ߼$߱$$߰'@tx $߿ '0%$t$s% (%< %$#$!8'9g@ % ߱Y,@ % `(%@)߿0߼߲ Q !0!߳(߰ %߱'`C0gD'ߤ %@Dߤ ' @!Dߤ '(@! я8Ύ3@ %x@%'0ߦ $߼߿0߰%߲ ߳('` $@@% $@% $@%'< $!0!!($` % @%  % $D@ % (% tx $(00\XPHD@<840,($$T$ Lߡߨ4 ߡ8<@$!#$ `HD ($ Lh߿(߼ %߰߱0'`(8(%$4  $f㏈8 % $( % $(%߿( % $( % $(%߿( % $( % $(%߿(0B < '$B"!9$% '߼߿߰'@'@%H%P%X%`%h% %߿'00 <@@$ <8``P%$ 8`P% @% @ 0, `%$ ,`% '0 %߿'00'%8&1q %0%  % l00 %߿߱40߰'0'0! % %  $߿$߰' x %0% $P߿߰' '8( '9s% %@߿$߰ ߱('P4" 0,,4 M%@4E F9'0#(! $@IAC"!aaA,@GCg 0@0$$$@ 0 ώ,@ %Ю00o0s<0/߲0߱( ߿$` 0,@;8AH6߰ 'P0c`߿߰ %߱(߲'P$G0$ H 3 +8'9r  %,0 ߲ $$9 H ƎA  08'9q %@(% l0%,8'9vߤ(% ߿߰ ߱('PӮ4  ߣ`͏8 (ߤt@(%ߤ $Ï8tx $'9 %4 0'%%%߰߱'`<'9p %( \$, ,0 Mt @ 0C` 0 9'$' 0$A$L00 %BLP@@%BLP@tx $LGL߲0 9ߥ  ߢ !   @@%  @ % XH$ % Ӹ ߿( %߱߰'`x $ < '8$!%0!!(%߼8߰0'p8'9jH  %$ tx $, D P@  % %ߴ@<@'9\ DPHX  % %  %%ߵX(Pߴ@(%  %  %(ߴ@,߱P"* 5@8'9s0%(%ߤ(5 ߰0@߿H$߼8'p%߼8߰0'p'< $!%@ !!  @ %߿߼$߰'@0c`\ 8'9{P  %߿߼߰'@  $߿$߼߰'@ %@0%ߥ  $ ߿$߼߰'@'0hH`@P@%X8%%x%%p%h`H8@0&1s߰h,%$ $ X!H#*%k߬0`%A $A$B,P0!@tx $p@!t!1E@0%H%#u! %(%0%  %@߰h߱p߲H߳ߴxߵP߿@߶X$߷8߾`'Џ(l1A5E@0@(%$' +%'  X%*B@P%$ %0%$&b l (x&O %/( &c$(%E @@%F%e@ , $  %J$hE` $l@ &(& % e@ $DNH%E @%&%e , A$  %J$aE` $l &(&@ %@ e %N$#`H%@h%E Eh $ $ , $ e`  %%0߰h߱p߲H߳%ߴxߵP߿@߶X߷8߾`' @%` $ $%C * p5E@l0@`H% h%@% %(% @0%X@%` %(% @0%2HPH!(% +' $  @P% X̡!$ % &$ $ b`@%)bh%$ @ %(% %*`H%K&@ % &)&p& &i&& &%%¨ % % G% '% G% 'i& g% ' % &I&&i&)&& &%% g% G% g% G% g% G & g u% '%iX&ɠ&&p&) && &%% G% '% G% '% G% 'I&@ @%߳ߴ p%8`P%߲X%@%ߵ&1s%$ &%ߩ(%&f8&# &8@ ! %' $ 9` G&F&'0&%& %%#` G9H 'xT $,@,@,T&, Q,tx $8`t$ 1A  h5E@d0@߳%ߴh% P%8 @%@%߲ߵ&1s`%߳h%X%ߴ @% P%8@%@p%߲ߵ&1sp%%$ (& @& %@ %iX& &)&IP&h $ a% %%P I&@ A%(&a% b0 $ ߦ0C &$D $ @ F &bDh f ( $d @ 0 0$S|'Ќ< $!% !!  %߿߼$߰'00@(4@\`,888'9s %(% 0%߰@߿$߼'0  $߿$߼߰'0߼%߰'0  $ ߿$߼߰'0@<<'%%8 &q %(% 0% l%@@@%ߴ߿߲  % ߱8߱ 8߿߰'@8' '9s% % (%@߿$߰ '@@ #* % #81%8@@@)D @@ ߿1%߰ '@ ߨ9 'ߦ(! $@0ߧ@ߡA*b! 4c߿%߰ '@خ<T $TˬG$ 4!1  $ ߿߰ '@  ߿4cخtx $߿'P@<$ H0%%%h8%$%#~*\b j$qJtxP $߿P\8%00%$ @%$T@%P*@#4BaX#%` v!cj %k`vP!JA+ % @<8'9q %(%P l0%߿P%߰8ߵ@߶h߷H߾0'%d* $$  $ P@U %0%v(!P $%߿P^P!ώM %0%v(!P $߿P^P!ܮ %H%' 3$ $  `!́!E&% $' X`@%)c`xp%x p`X(h%%`%%H%`%E&`(%@ % &)&p& &i&& &%%¨ % % G% '% G% 'i& g% ' % &I&&i&)&& &%% g% G% g% G% g% G & g % '%iX&ɠ&&p&) && &%% G% '% G% '% G% 'I&@ @% p%߲`X%`%߳p@H%ߴx %ߵh%@%$ $ &%&$&&ߪ(`&d& &Ih %D B %'߱X%Y L %C G% %A` ߿P8P GP*% %&$*`jP*@v(!P!%a!0@$!'&j%d*@$!$ ߵ@%߷H߾0'Gc*&`Kv!!'k%aH$̮0``P!E&* sb*@nv0!%c$ H!F40 0$%$Bm0%߰8ߵ@߶h%߷H߾0'߰8ߵ@߶h%߷H߾0'߲`߳p% h%ߴx@H%hߵ@p%߲`@%`%߳p h%X%ߴx@H%]ߵ5J&$$ !$ 0cj߶h߰8ߵ@%߷H߾0'߰8ߵ@߶h%߷H߾0'&4߰8$ ߵ@߾0$$d$߷H'e&% E&% %&% h&% `&%h eX&%@&` EP&X%%X (0 gG'%g'``( 0$P%%!!@&&18%5+H%$ %xX2$!ߣ,$ :E$t ߤ$$@&15P+@ߣ߿X߶`߰(߱0@%߲H߳Pߴ@ߵ ߷8'%$ $ $ ߫%&ߡ+$5k+%(&ߣa$4!լae+P &sЭj%$ EP&-JJ ߪC$4cíC%$ eX&-kK ߫j$5Jje$ % &s`J &sK &sߡ!$ A &ca ߣc$`߫jߣ%Jj߫`jAP$j$&s$&s'<@%%0!+ <ߦ(%'9 '' % H@ 􏙀<߿ @ߡ߰%'@߰$'@('$@ %  @ %߿$߰'00 B0\`4:$0$<'9 % '$@ 0$ 0߿߰'0$, 0 4@<'9  %@㏙<4@߿$߰'0߿$$߰'0  $߿$߰'0 $Ů  $ ߿$߰'0'< $! % !!   %߿߼$߰'@0B@\`   $߿$߼߰'@<'9  %߿߼߰'@  $ ߿$߼߰'@' $01!(%% W%$#H$I U%<&s@ %00#(! `%@@%!* @ %Iߴ߿߳߱(ߵ $"$B߲0%߰'`I1#1(` 1'%߰߱(߲0߿߳ߴߵ '`< $%߰߱(߲0߿߳ߴߵ '`!$A<'9 @ %@߲0߿ߴ$ ߵ A ߱(ߵ $߳߰'`#H$I߱(߳%߰߿߱(߲0ߴ'`'< '?!<0'9`%( %@%߿@1@%@ %8 (!%԰!<& %r0#V(! %R!S*  %߳0V!$ @ߵ(cf&&FÐ  %(! ߶8߼ ߰߿߱@%߲ߴ@'`߼ ߰߱$߳0ߵ('`'< 0'P?!<('9` %8 %@%߿@9@%' 8@ %ߦԏ@ % 2(!@ %@ 8(%%!H<& %0#u(! %S!p*  %ߴHu!`߰8$ cf&&fØ @ %h(! 2ߵ@߼0߿߱ ߲(`%߳'`߼0߰8$߱ ߲('`'%< $!%@ !!(  @ %߿(߼$߰ 'P 1C`:1I\ ߼߰ 'P(  $߿($߼߰ 'P@ %($ $DKP$ ߤ߫߼@0%߿(`P%X!A%J$K@DD<ߣ`@ @ @%߰ 'P(  $ ߿($߼߰ 'PE <@ @<'%< ( $!}p% !!0   %߿0߼ $߰('`0c`\0   $߿0$߼ ߰('`8'9s % (% %@߿0$߼ ߰('` ! <H%@CGB g#@iH!0@HAB @#@ !,@6GCg*`14c@HA@# + !ߦߧ$<8&@#'9p(%0  % \$g$0a%$ * 9  (%@  @ %߿0$߼ ߰('` ߦߦ  $߿0$߼ ߰('`$C$0A $G8$8'9s %(% 0%@ ߿0ߡ *$4!% 9 8 $ߥ8߿0@@ %  %߿0$߼ ߰('` 9ߦߥ' $@(%A߿0ߣ`%߼ ߰('`0  $ ߿0$߼ ߰('`  $߿0$߼ ߰('`8  ߥ8߿0'< $!y% @ !!  @ %߿ ߼$߰'@8'9s % (% %@߿ $߼߰'@1 _%\`F FJ< 8# !0 f#b!,8*5@f#b!Y'$((% $߿ @(%A4ߤ(##߼߰'@@(  $߿ $߼߰'@  $߿ $߼߰'@  $߿ $߼߰'@߼ߢ߰'@!  $ ߿ $߼߰'@  ߿ $߼߰'@< '0A$cw`0E #!l @߿%$߼' 0B+<% ##"!( < E*@TT'< $!v!!%Z% 4'x$' <$@ T' $'8 <'$ (% <'T %'' @tx $ h %xx %@%$($ߦ  %%$! % %'H'@@% %0!&R &sG8* %߳ %'P0 %0!8% ߲߱' 8߰菙 ܏߱$  ߰߿߼$'@'%< \$!t%%%@3!!CpHI 8'9s` % (%@߿߼߰$߲߳'@% _߿'`'X3?( ߤ @% ߿߼߰߱%߲߳' @ %@%@߿.#`$ bH  P$b.! ChA i$b.) A#Z {.(ĒI$e!.#$ t `H  9 `(%ߧ@0% ߱߼߿߲߰߳' t߼߰߱%߲߳'` %@(%0% ߱߼߿߲߰߳'x@ % 0% $@@߿ ߨxߤ $@߿ߨ1ߤ 'h߿ ߼߰߱%߲߳'x@ % 0% $P@߿ ԏxߤ $PԎT 'ߤ '߿ ߼߰߱%߲߳' ߨxߤ $`߿ߨ$ 1 ߩ1) '͈ 'ߤ '߿ߡ0! ߣ'͈ 'ߤ '߿ߣ$hh ^߼߰߱%߲߳'x@ % 0% $p@X߿ ߨxߤ $p߿ߨ$ 1 mߩ1) ߨ@$A$Coߤ 'ͨ߿ߨ1 ߣ @|$ I$Afߤ 'ͨ߿ߣ$hR '߼߰߱%߲߳'x@ % 0%$@ $X@߿ߨ1 Lߤ 'pJ߿ȏx@ % 0% $`@m߿ ߤ߿ qߩ ߤk߿yߡߤ '̀߿ȏߤ '̀l߿ȏx$@ߤ $X ߩ ߤ߿ ߤ߿ȏߤ '͠߿ȏߤ '͠߿ȏߤ 'x߿ȏߤ '͐߿ȏߤ '͐߿ȏߤ '͘s߿ȏߤ '͘|߿'p8(\< H@$Bm%0 "!$߼@߰H'x %0%P $߿P8'9sP % ߥ8@߿P$߼@߰H' ߤ0,A @P%ߣ0c$bh$ jX+` ߡ0!$b#,`ߣ0c$bhk$ jX+` ߡ0!$e#?`ߣ0c$th|߹89 9 ߦ0ߤ8ߧ((% ߿P߼@߰H't %ߥ0 0%߿P߼@߰H'x `@0%$@ߤ0 $߫`@ߪ  ߤ(ߪ(J$f @%H_߿P$lAg$nCp%߼@߰H'x X@0%$@ߤ0 $ ߫X@ߪ T %'ߥ( '$F ߿P@ߣ8F$Hߧ8z ߿P$߼@߰H'x @0%$@ߤ0 $@ߪ x ߤ(ߩ8(H ߿P"T<"* %ߨ8$T%߼@߰H'x@0%$@ߤ0 $0@}߹8T %'ߥ( '$F߿PFq$Hߧ8E ߿P$߼@߰H'x @0%$@ߤ0 $X@@ߪ  %ߥ( '$H߿P$߼@߰H'8'9c ߥ8 %, ȯ߿P߼@߰H'x %x8%$ $߿P$߼@߰H'x %x8%$@ $~x %x8%$ $Pߧ80ߩ8(0 !ߣ8!a`` ߿P%߼@߰H'ߧ80J0 @%@%@PI Oߢ8Bߣ8cbߨߩ) D'$ @Dߤ 'Ͱ@+Dߨ8$   ߿P%߼@߰H'0 ߩ8(0 !ߣ8!a0`J0 @%@%'ߤ $@Dߩ8$ѭ( ߨD'ߤ $$@߿P%$߼@߰H''ߤ $@:Dߩ8$( $߼@߰H'Dߤ 'Ͱ$@4߿Pߡ8 $@0%'ߤ( $p@߿Pߪ(Jߤ('ߦ  $`@߿Pߪ(Jߤ('ߦ  $h@߿Pߩ8($@$5 ('ߤ $@Dߩ8$v( D'ߤ $$@.߿P$Rߤ8D '͸ $$ߩ8"@ _( xߤ $@Uߩ8G ߿P$߼@߰H'ߧ8<$ %'90$$0$ 0+$D'ߤ $$@ ߿P$ P%8%NP%Q8%D'ߤ $$@߿P$ Dxߤ $$@3߿P% ߿P$߼@߰H'xx %@%x$$ $$( ߣ8a$($aߡ8)$#H$5))xx %@%x$$ $я$ͯ'(@P%% %%80<&־@%  %3@PQ %(%0% % % % %߷ ߵ(߱0߿8߶@߲߰߳ߴ'`< ' $!bP!!@% %0B@ 2#`8'9s %(% $$!$,D',8% 0$ (%   ߱D p %߰߿,߼ '@<'9 0 %򏙏DH'4q0b 2!0@ %<$ "* X` '$ 9  (% ߿߰߱'0< %0% x$X'< 0!@$B`% "!<<C*@< %0% x$$ % X߿ ߰<'9 % 0X߿߰߼'0'< D$!_%$@%!!Cp ߡHI !@ED %@ HCd %HB@ <'9 0 %߿ ߼߰'PB@܏(  $P@ߣߡA Cߥ(D_߿ ֮D'< DH%$!^0(%$!!P  f ,߼(H%߼(߰0'` ( 8D8$  %D %Hd %H<'9 0 %߿8߼(߰0'`P'H%@%@!@%@%$ FP$P< %0% $@   %߿߰'0' (P%%%0%01 r0  $@8%@%<` %@(% $ƾ@ߨiP hP  % ߱ ߲$D ߳@ %(% ߿0߰(ߴ'` '< ($B["!@  %  % @(%@߲# ` $ %  \߱D % p߱߿ ߰߼('@<'9p % (% ߦ폙$'$ $< ($![%%%!!C0x %x@%$  $߼߿0߰($߱ ߲'`0 ߩ$r!=@0%ߣ$wh(x% $P@"$, %0% \$@7߿0ߡI!H$ 9xCL c<'9  %@(% Hߦ߼߿0߰(%߱ ߲'`x %x@%$x $`߼߿0߰($߱ ߲'`8x@0% $@@ߦ8$߼߰($߱ ߲'`x8% %x$ $ߩ%J@$P+H& I0 ߼߿0߰($߱ ߲'`GP ߡ U!t %0% ߿0߼߰(%߱ ߲'`<'9p %@(% ߦ߼߿0߰(%߱ ߲'`'< ($BX%% L"!ȏP  %ߣ(c`Q߿$iE_$mp$ nw$oE~$qx$r&R@$t$wx %&E ߦ@x %0%' 0߰@%@3߿߼%߲߱'x %H%0%x&E% $ ߼߿߰$߲߱'x %x@%$ȎF $߿߼$߲߱', %0% \E@@%@߿@ % 4'@f߿ZA ' % ߦ@~߿$ i%$mx %ߦ $ X@߿ %' ߦ@߿ %' ߦ@߿ %' ߦ@߿Ez$qx %ߦ $ @k߿ox %ߦ $ @߿gx %&R@ߦ &E$r@߿a 4 % 4'@ ߿A !0!$E $C(hE߼%߲߱'x %ߦ $ @k߿? %' ߦ@sߨ8߼߰$߲߱'ߨ$  ߰ȏx %x@%$F $߿߼$߲߱'ߨ$  b߰ȏx %0% $ h߿߼$߲߱'ߨ$  k߰ȏx %0% $ h߿߼$߲߱'ߨ$  O߰ȏx %0% $ h߿߼$߲߱'ߨ$  a߰ȏx %0% $ h߿߼$߲߱'ߨ$  :߰ȏx %0% $ h߿߼$߲߱'$  <߰ȏx %0% $ h߿߼$߲߱'ߢB<@0%CHB h#@f0!' ' %0% '߿߼%߲߱'ߩ)1) T' 4 %'ߡ!0! R % 4'߿߼%߲߱'ߢ0% %B'X'`0B b( ߿߼%߲߱'E 4 %ߥ  % 4ߨ1. % 4''ߩ)1) , % 4'ߡ!0! *x % 4$ ߢB0H % 4&E`ߣc0c` x % 4$ (ߨ1 % 4'ߩ)1)  % 4'ߢB@S$Ce$Hs$ IߢB @X$Cf$Ht$ IߢB<@0%CHB h#@f0!'(% @% % 4'ߢB,@0%FH0#ߢB0@'CHB h#@f0!'(% @% % 4'` ߤ@(%' @% % 4'ߥ'@% $ % 4'߿߼%߲߱' %0%' 0߰@%@߿߼%߲߱' %0%' 0߰@%@߿߼%߲߱'@ % 4'@G߿@H(@ % 4'@X߿LA ߥ %0% ߿߼%߲߱'ߦ'' $ %0% '߿߼%߲߱'ߥ  %0% ߿߼%߲߱'E 4 % 4'@߿H($  $E߼%߲߱' 4 % 4'@ ߿A !0! C($h$EE߼%߲߱'0I  l % 4&Ehߣ %' 4&Exߡ % 4&Ex߿ %' 4&Exߩ % 4&Exx % 4$  % 4&Ex % 4&Exx % 4$ 8ߨ$  ߰ȏx %0% $ h߿߼$߲߱'ߢB,@0%FH0#ߢB0@CHB h#@f0!' ' %0% '߿߼%߲߱' % 4&Epߣ % 4&Eߩ)1) A % 4'ߢ % 4&Eߢ % 4&E % 4&Exߢ % 4&Eߢ % 4&E % 4&Exߢ % 4&Eߢ % 4&Eߡ!0! x % 4$ Hrߢ % 4&Euߢ % 4&Exfߢ % 4&Ex`ߢ%'p(H< X($cI`PH%% #!`@, %0% \8@߿`߼H$߰P߱X'x %x@%`$  $߿`߼H$߰P߱X' ߥ@@%$aP߿`$ dX$la$rxߤ%ߦ $ $ @߿`ߨ@ "x %x@%$  $߿`߼H$߰P߱X'xx %H%x% H$ 0ߦ $ ߿`߼H$߰P߱X'߰8P<0%ߤ8 $@   %  %߿`߼H߰Pߨ8%߱X'P'ߤ @0%@߿`ߥߤ'  ߦ@"߿`ߥߤ'( ߦ@*߿`ߥߨ@$  Vx %x@%$  $߿`߼H$߰P߱X'ߨ@$  sx %x@%$ 0 $߿`߼H$߰P߱X'ߨ@$  x %x@%$  $߿`߼H$߰P߱X'߰8Px$!@$#($!0 ߥ0$C&ߣ( % 4b(  % 4򏙏߿`߼H%߰P߱X'Dx$@  $@D$  $ߪ8ߩ KPKBPI QJ $D ߱Ȯ"@ % <ߤ8 8%ߥ $ƾ@߿`߼H%߰P߱X' %' l $H߿`ߪ8JP0%(@(%p$* !@(%@$*`@(%@$(*@(%@$@*@(%@ $H* @(%@$* @(%@$JxEߨ8P@ @%%tx $ ߥ߰<0%ߤ8 $@   %߿`߼H%߰P߱X'x$@  $@$k x %$@@%$8 $ ߿`߼H$߰P߱X'x %x@%$  $ ߿`߼H$߰P߱X'߼H$߰P߱X'x %x@%$ h $ P߿`߼H$߰P߱X''p(H< 8+$BA\0%%%"!@$ h \ |$0 DL0Pߩ1)P2 8'9c %(% .F@ߡ A8ߦ '9c % (% 0+߼(߰8߿P߱0$߲@߳H'$($4 $T $(ߪߡ)T@ߣC@%ߢBA JPQ`I i%)i߾'@" %x0%'  $  % h߰| ( %@ %$ 2H' ߿ߤ 8' @%%߿ O$y$߲߷(ߧߡߣ `@%'P '@>߿$߲߷('X '@4߿߲߷('` '@+߿߲$}߷('h '@!߿߲r߷(h< '$!)P!!% $߼@$0$1߿(+ D$߾'0< '$!(!!|@ F gp߼DC @@@^׾'0 t|߿< '$!(`!! H߿߼'0' < (!$B( %  "! \ % ߿ 9  % ߱߿ p߼߱נ ߰'@tx $ (菙< '$c' #!p"%߼%߰'@<'90 (%߼@߿߰'@ߡ!Ԁ< $c&#!"p '@< $c&x%%  '#!p'2$'@ % ߿B !߼x߰$߲߱'! +D8+#߲߼x$߰߱' %p 8'@%x@0%' $ X % h߲| ( %@ %$ 2H'߿ % F F߿<4G88!8$ $BD8+H@@!@$ߡp ߲߹p9 p  %נ߿p߼x߰ %! ߱'< '0$!$(!!8' % % (  '@% $D@ %' ߼0߿ ߰8߾('P< '$!$0!!|@ t߼EC D@@'0@ tߤ|߿' < (!$B#%  "! \ % ߿ 9  % ߱߿ t߼߱ߣ ߰'@tx $ 菙< '$c# #!t"%<'9 (%ߦ@߿߼߰'@߼%߰'@< $c"#!"t '0x< $B"%%p "!Ь@j @@!<6@$$+`8%$-H&H!)4H$ $%g %0% '@ %߿@%$"ߵ(!)!^ߵE+ H@@!@$ $BE@+I H&H!)4H$  ߴ ߴ߼߰$߱x߳'ߡp߹p ߳9 t  %߿ߤt߼߱x% ߰'Џx`0%' $  % h߳| ( %@ %$ 2H'߿ % 8'@%}߿0%'$  %@ %߿ߴ ߳߼$߰߱x'`8%@ %0%'$  % #߿ h %| ( %؏x@ %$& 2H(% %@%x8%'΀ $ ߿< '0$!@(!!8 %' @% $D@ %' ߼0߿ ߰8߾('P< '$!!!|@ t߼EC D@@'0@ tߤ|߿< '$!P!! ߿߼'0' < (!$B%  "! \ % ߿ 9  % ߱߿ t߼߱ߣ ߰'@tx $ 菙< '$cp #!t"%߼%߰'@<'9 (%߼@߿߰'@ߣa$!< '$!$B"! ߼'0 ߿$C*|' ߿' ' ߿' ' ߿' ' ߿' ' ߿'0< '$!!!%% $$4F$C$ s0 A߳߿߼߰B'0$ ߿߼%߰߳'0< '$! !!8 ߼(C߿`߼'@߿ߥ$'@< '$!!! ߼(C߿`߼'@߿ߥ$'@< '$!@!!%% 4  $@ T $ Ў1(F T'T %P$D @   %߿߼߰ %߱'0< '$!`!! %߿$D &c߼, ߾'@< 'EP$X%$!@ !! %g@(% 긏߿߼'  %߿%$ $%'< $!`8!!(0%% %,C` %@0% 'Π@t<'` %''9$ $ߥ $@߳(߿0$߰8߼ '`t` %(% 'Ψ߿0߼ ߰8߳('`<ߤ'9@' P߿0߼ %߰8߳('`'X0@< P$!PH!!8%'Έߤ8 $0%  %@0%, %'Έ $@ t(%'Έߤ@ $ ߿X߼P߰H'<ߤ0'9@'  x' $ 0ߤ8 '߿X%߼P߰H'<'8'9'0 |% $<'$$T'9 %$<4! ߿0߾8'P<'8'90% |'<'9 d'$m<$5<8$$n4B߿0!&$ ( $s$$00$$8 &,c A( $0c@$+ ߷8'P$e$o$'<0@'98%% |'<'9 l'<'9Ў t'$nH%$ 0$m$ <$s@'@$'%&$o$$$$ &8,F $ bP '$T %<$I% $ '9lX&4l@8$ g% ߿8߰0߾@'`< 5)5)P%'x 0% %x'(' $ @$F߿($߰0'px %8%8 $ P߿(ߢ "!! 폙l 'ΰ@ߤ߿($߰0'pߡ&(`( @ߤ߿($߰0'p(߿(߿($߰0'px %8%8 $ x߿(x %8%8 $ ߿(%߰0'px %8%8 $ ߿('H< 8$!0!!@(% $'@%@ %$$$ $2@߰HCH tx $ ߿@%߼8'p $(pߤߥ F'߿@@@%%߼8߰H'pߥ  % ߦ0@%@H% 8' ߡ j߰H߿@%߼8'p %$ $0%' '$ ߰tTD TP@%ߢ( %4B b@<'9  %|%JOp%J(|%JOp0@ %ߧ(ߦ '@%@(%ߢE \ %(% $$@;߰Hߥ|ߩ%Op%( ߰Hx|x$Hߤ $8ߥ@D  %߿@%߼8'p $( (߿@%߼8'p߿@%߼8߰H'p (ߤ@@%xߤH%'θߦ $߿@ߨ Dߥ % ߿@%߼8'p (ߤ@@%H%x'θ'ߤ $ꏙD< '($!p%0!! 5% 0%'8 'T%@߿8Cqߣ R @ $|ߩ 0T@@%@%J @0%'T 8%5)I$Op ĬQ߼(߿8߱0B߲'PA߱0#߼(B߲߲'P߼(߱0'P< '$! `!!% $ߣ$4FH@$b$0 G8$4Bd $ b@߿߳߿%߼'0߳߼B'0'0A % 0B$+`0 $ T0c`߿ 0G$0H$߰'@ߧ#$%߰'@%߰$ ($߰'@ $$$ F0$ߢ߿ '(< ' ?!<'9 P% T(%@߿($߼ 'Pߦߤߥ8% (H߿($ $ ߨ߼ 'P߿(߼ 'P߿(%߼ 'P'(< ' Ь?!<'9 P% T(%@߿($߼ 'Pߦߤߥ8% (H߼ ߿(߼ 'P߿)߿($'P< '$! !!%   %(B  ߿߼߰%߾'0'$< $! %!!%0$ p.`( ď.$sb  #hVx %߼߰߱'  %@%߿؏tx (%ߤ $߿߼߰߱'ߤ'' @s߿'   <@(% ߤ $$ ' @ߤ E '   <@(% ߤ'ȗ  'ߤ '߿\%߼߰߱' %0% $@߿؏ߤ'' @L߿v'  <@(% ߤ $$ '@ߤ E '  <@(% ߤ'ȗ 'ߤ '߿>߼%߰߱'Zߨ)߼$߰߱'x %0% $X@s߿H ߤB߿ߨ߼$߰߱'xߤ $X ߤf (ߤx@0%8%ߤ $h߿ ߤ0߿ (ߤx@0%8%ߤ $߿؏xߤ $ ߤ< 'P%$!p !!G % 긏߿߼'  %߿%'@P8h0%<(% 0%pX%'9@` %'H $@I@ <@<'9@' (% @0%@>@0%$@ $@%@5@%$$ ` %(` % #!J($ tx $؏ߤ ߥ|@%'菆x@(% % $8| %x (%8% $߿(߼߰  %߱'@$(% $$'$$H߿($ %߼߰ '@ %(%( $$'H߿($$(%( $$'$C߿($Ќ!$ #%߼߰ '@Ќc$ f%߼߰ '@' < ($!!!,80% \'@P%@A0c`_80L8 L@ %|%kOp@P%K%aP*%$@<'$$ߤ+ Pb( @'' ( ߿0߰8@ @P%ߧ %߼('pD' D@⏙xߤ@%'ߦ $߿0$߼(߰8'p$߿0߼(߰8'pxߤ@%'ߦ $`߿0$߼(߰8'pxߤ@%'ߦ $@߿0$߼(߰8'pxߤ@%'ߦ $ ߿0$߼(߰8'p'@<< 4B@$!%%8$!!HP`'@p ;%$ i< < @4B@##5J #!!!P!H*&I  ' ߿@`HP`p%*) @h$X(%&1x  %&!& $߾8(&2033 3%@Qߢ`QB<4!B@(# #! Q%@ST PPP!I2H%QIBp!a2%aQB PPP!I2H%Iߤ ߦ0ߧ((% ߨ$ߣQBE P` ;'* u*%`%$4iPP!A2$aH CJ5!r$# RP$ߣ84)*H i$`ߢ߼߰h߲߱H߳ߴ`ߵp߿@߶P߷x߾X'$A Bߤ QBtx (% $uhP`p h'< 'H$Bp"!! #!X%!P%$w8@%0!%% 4$r# %%$a&$߼H$߰8߲@' %@%x'@0%P $߿P%D$+$X+@`߼H߰8@%߲@'$D$A$J6R P+T %0@(%'P( '@߿Px߼H$߰8߲@' %$ @% %ߥ( @% %' @%߿PXX $R$T(s6RDߤ 'P@m$Rߡ$!#*ߣ $c p ߡ !!11$$W#(D$1$A';$C(D$E!J$N#$TDߤ 'H@e$R$N'$TDxߤ $@$R6RDߤ '@$R$$G$ߤ ' @$R$$A$6RDߤ '(@$R$$A$6RDߤ '0@$Rߨ06R$Dߤ '8@$R6RDߤ '@@$R6R"߱X ߿P߼H$߰8߲@' ߡ߿P ߱Xx߼H$߰8߲@'x6R߼H߰8@%߲@'xx %H%xߦ%p$@߱X $(ӏ %x8%$ $߿P'pX< P$!H!!`h%% h%' 4@pp % (%x F'@%@8@%sK %' ߳p$GO %(%$  '`@@% % hߴx ( %@@% %H%x'X 0% $߳p $P@(%@% % x@=@%D(%r0! % ߳p@Hߴx߳p@ߴxߧ@' 8߼P߿h߰H$߱`߲X' @ %(% '$`(% <'ߴx   ( %@@% %H%x'X 0% $߳pD %(% ߳p % (ߴx@@% %H%x'X 0% $߳p % @(%$@%G@P%$`@%8߳pߢ@@ %  8'ߢ8߼P߿h߰H߱`߲X'H % $߳p88x 0%'p߳p $ % 'pݏ< $c#!"B< $c#!"D'< $B`"!% .@$ -@%@0% %@%8% 'h߿߼%߰߷'0hl\pd`<0%<'$$1X $0(<(%  $-߿'< '$p&!<<0%$1 $0߿X߼' < '$B ("!X % W%80 $@%@% ;'$80)@0!(#((!ߢ<(`4cB@(!߾<*ߤ0$!4`8!$߾ \`0%߷8߷8D*` %8* %$0%\<'90 % $߿(߼ߵ '`<'9- H< '$!p!!\@%D@%0%߼' \ %߿߼' 0 < '0$B "!h`#d  8'߿߼'0\  ;'\(#0# 菙䯠߼'0$<4BB@!گ0< '$B "!\` ;'\(#0#<4BB@ ߿d ߼'0$0!(%0%$$ d<@ %(%$1 F߿0< '$B 2"!d` ' ;\ %(*"* $<'90 % $߰߿ $߼'@ߡ"# 򏙀<\    %ُ\%߼'@< '$B "!X  % $@ ^ߤDlp C߾ ' 8l߿ ߼'@߾h<'9- H⏙'< $!p0!!h( %%)%  Qt %% 4 %  %8%鯕hl߼߰(߱ ߿ߴ0ߵ߶'P߼߰(߱ ߿ߴ0ߵ߶'P< '($!`!!h2% p&#b#@p %`h  % %h %(#' 8߼(߿߰$߱ ߵ'0䯀l߼('0'0%< ($cp%%h #!~p' 8I H @!1T % '$$@߿߼$߰߱'Џ$ߩh( !$ $ߨh$ ߡp Alߤh& ج$@ %x@(%߰ 8'  $ߥ@ % ߢxH%H<<0%$<$> x$ ߦpx$8 $߿߼%߰߱'ЏT %'(|@%'ψ $O@D߿x %x@%$Xߦ $H߿߼$߰߱' $`p<@@% %@8%x@@8%$?Q $( ߨ`' 8@(% % 'cX %x0%$ $߿߼$߰߱'Џ(@8$Hs$Eߨh߼%߰߱'Џ' 8 ߰ $ߥ@ % z<ߩh$!X %'ϐ0% $߿߼$߰߱'Џ :$߿߼%߰߱'ߣh(c`%ߨh$  Xlߤh& ج$@ %@(%X 8' @%߰p ̸0x$ $8@߿' 8<'9=@%@(% pߤp@Y`ߥ` % 4%ߦ` %%'Ϡ 'Ϩ 4( #߿߰pߡp %'0 4@% ߡp!1x'0 $8߿߼%߰߱'Џ' 8F@%XߡXP/< ߤX"߿ @ %g<'$ % 'ϰ@߿ %'@ߤ$ '$ ߦ߿ @(%ߢ%'@B@߿ Ce߿ B@߿ %'@'@'Ќ< $!ۀ%!!$ 0% $0%@  %  % Ď@x % $$  \ %D p %߱   %߿߰߼'0'% 0%0%   %߿߰' '< $!%)!! ( <(% $>@ @% %@ @%% & % `%߳(߰  %@ @%߿߼߲߱'@T`'P8 pxPhH` %p%%< 0$c0(%%%%%$(@#!% ) %@i$%$$$ $` $$$)#%%2k$H(p0 %(%0%  8%B  !߿H2@ h %߿H߭v %(%0%8%' '' '@ ߿H@)| % (@%A  % (@%E@hߡ@$(߼߰ %߲߱(߶߷߾ '% % (@%@ % 8(%@(%t % $߿H$ ߭$ߣ``%ߣh߬H߭`m` H%ߡ߬P,c @-` P`H(0 %L % '@`߳es( % @ߤ@XP3X`%@@ď@ߧ'9ߦ(%@ l %߿H ߣH`߬PFB$(&$R8& !4R΀C` ߣXA#񏙂D  %T@& % ߿H߿H߲ߵPߴX߬ߤ߳` 0(% 'l߿H@'9 h0߿0 @_ @%d߿HߵPߴX߳`ߡ Q$(%"0Lߡ1"0Mߡ A0C`0L@0Mߡ pߣ`7߬p5߭8ߡ(1ߣ8`߬0$0ߥ '߭8@%@%߿Hߣ8$)a߬-ȏ@'9 h߿Hߡ P @%B$,C$4B@ " Q  $(@* @#@ߧ'9ߦ(%X l %߿H0@%Q @%Y' $D@'9 h@%B R _@%߿Hߡhߣ`$ @ @ߧ'9ߦ(%T l %߿H$!%@2`@ߧ'9ߦ(%@ l %߿H $4@%@ %@%8 3(%ߡߤ8J1 Q ߲$, (%߿H2 @ߦ'9 %ߧ(% lH߿H%$] ߣ`2 @ߦ'9 %ߧ(% l@߿H%$x$$4C$$4BC$ "@ %" 3(%߿H߬x<, ߥ߭8@%߿Hߣ8$)a@ߣ2 @ߦ'9 %ߧ(% lL߿H%$ߣ߬VJ@'9p  %4@< '% (!(8%0% ҈4߿߼'0'8H0< $B"!%%%(%% %|@%@%@c %%߳H) ) &@ %"`0%ߥ %!|3! 3߳H"$C"#, % (%@0% |8%(%@%B(߱@@I%) qIM%߰8߼ ߲߿(ߴ0ߵ߷'p  %|@%@%|) %%߳Hc@C &@ %(%B `0%H@!S߳HB$II$!$Q" @Y |  %|h(q߱@| % (%I  % (%E ߰8 % (%@ %(% 8߰8@(%t % $߼ ߲߿(ߴ0%ߵ߷'pD!$B @|Y | @ %|hH~r t|@> % 8(%w߰8 "  %B t|y'0(@%< $!%8%% %%@v!!@@%@` %Dx%H@%` %(%0%  8%'$ H%H 4'@%@:߿HC`@ @@` %@0%8%'9`@%2) 5)2!@ ߿H !@'0%'9(%` % l@@%߿Hߵ@D '90@ߴ@@'9@ % 4߿H߼ ߲߰߱8%߳0ߵ('p$߼ ߲߰߱8߳0%ߴ@ߵ('p0@0@)2#`@@1) @D0*@ ` %(%0% l'B߿H0B %H@ 8(%@%߿H@ %H 8(%߿H揈L߼ ߰߱B߲8߳0ߴ@ߵ('p'T!(@A!A< 0!$Bɀ%"! QRC0c`I @B0J@0A 4 @'(0%@'9 (% %D0B lb@ ߿(߼߰%߲߱'P %(% 8% '9`@%$ ( @0%ߦ @߿( @ % (%'90%@@% l'߿(߼߰%߲߱'P߼߰߱B߲'P'p8 @h`H< X'P8!%(%T%(@ % 8(!0!@ % )0 00`ߪ 0@߰h@'9ߤ@0%@ l' !0! @'9 % 4(%߼X߿@߱`%߲P߶H'ގ0' @(% U@%`L@'9 hߣ(B R A@%$c#"$4!@!) @ߪ @ߪ @ߤ'9`(% 0%ߧߨ0 $ @߰hߡ %@ߦ0'9ߥ@@%'ϸߤ l$8$ߩ8 ߪ @'ϸ߰h@'9"0A 0C`ߩ ߦ0ߥ@%g8Dߤ0J l@ $8@'9p  %@Q ߼X"߿@߱`߲P߶H'%'$< $cP%,#!$< %$G0% ՌE@߿$߼߰'@x %x@%$F $߿$߼߰'@t %@(% $߿%߼߰'@( %$0% ҈E@߿$߼߰'@t %@(% $߿%߼߰'@< '$B"!<%0%4 Ռ 8%߿߼'0'`< 0$! !!%(%%~%@`%|󏙌Hc %%8J@J8 &@ %Bߥ 0%A0! PBP$BB  %@%@%Xc %%ߵPJ * &@ %(%" 0%!5! 5ߵP"$C1#@ % (%`0%@8% ּߨ)߿8%)@% M)߱X`j%J@|jA$!ߴ` AS߲H%߰@߼0߳(߶ ߷߾'@8 ߤ`@%~߿8  %@%@%c %%ߵPJ`j &@ %(%b 0%a5! uߵPb$Cc$)$]" @Y   %߿8*߱X| % (%A  % (%E ߰@ % (%@ %(% 8߰@@(%t % $߼0߳(߿8߶ %߷߾'dcd+b @Y  ` %߿8is8 tH ߿8 tX- @ %f߿8 % 8(%߿8e߰@ ߿8 %߿8 to'@0( XH< `X%$!P%%@%%@!!h@% %%p@% %(%@0%  8%'$ $ p 4'@%2%߿pW%11 `1  2*@ @ %'9(%@0%P l'߿p߼@߰P߱H߲`%ߴXߵh' 2)1`2!x ;@ `a$!  a%׏`| )  %$ca(!  %`(% ߦ߿p@8߳x߰P߼@߱H߲`%ߴXߵh'߼@߰P߱H߲`ߴXߵh'ߪ`c$c`cߤ 8'X@ %@% x' H8ߤ8@% $`b@(% % 쏦ߪbSi߿p%)iߡ3$c$$6sd$3߳x$H$ߪJ@@ ߩ  ߩ @ %8%'9`@@%2)ߦ 5) @%@߿p2! @ %(%'9@0%@% l'߿p$(ߣ( ߩ ߥߵh <0@'9ߤ 4߿pߢ0߼@߰P߱H߲`ߴX' @ %'9(%@0%D l'߿p߼@߰P߱H߲`%ߴXߵh'` %ph 8(%@%߿p ` %ߣba$! oa߳si%)Oi0 0i0 %p 8(%߿pߤ 8'@%`G@(%i)) 2` % 2Ho߿pSmߣa$!`hac$c`dcd)$`g | | ` %߿p|AaPS ` %߿pߥ t| ` %ߣbb$Bߥ@&b߳si%)ȉ % 1h߳xߡ"_'_&߿p ` %߳߼@߰P߱H߲`ߢߴXB' ` %dcdg | | ` %ߥ|*jȭ3 ߿p ߥ'T0!(@!`%@%(< 0!%8$c #! 0`00 0 @ @ %'9`(%0%HP l'߿H%߼8߰0'p `Q %)%J@W $ ($$ 4($ @*0@@'9 %H 4(%߿Hߢ(߼8߰0'p@ߤ(%'9`0%@%Hߧ $ @߿Hߡ  @'9ߤ0%@@%ߥ l'߿H$ߦ׎0`0 :H H(߿H @ %'9`(%0%HD l'߿H%߼8߰0'p!- | |@ H ߤߨ߬߫ߧ ߢ@߿H|id߼8߰0'p@ H  %ߤߨ߬߫ߧ ߢ@߿H'@H@8h(XPp< x'`8!%(%%%T%0@ % 8(!@% 0! < 1c`1i1j@'ϸ@ 1a@W &`%@* ߰!0! @'9 % 4(%ߢ߼x߱P߲X߿h߳ߴpߵ`'ߡ'ϸ @@ߥ'ϸ&@0%ߤ(&@H l%&$ˎ 0' ߥ  @%`1@'9 hߩ0B R A$)I#$4!@AQ "0J@%ߡ ߰ߤ(ߥߦ &@D l%$$4b$4B @ %(% 3@'ϸ&$ i$@'9p  %ˏ@2ߡ82 ߩ8)#$c@#I%) 4I"!$ JP$5J$CP$ *ߪ@ ߪ@@ߤ('9`(% 0%ߧߨ $ @ ߰ߡ ߤ(ߥ&@@@%ߦ l%$HߩH@ߪ@@a߰"0A 0C` HWD)$B @|Y | @ %|AAR߼x"߱P߲X߿h߳ߴpߵ`' B '@ < 0%))!$,$+(8b % | 8%@!@%J)JH@% %(% $'@"@% ߲H$c߲H`3߿8߼0%߰@߱(' @ %@%$x %$߰@  $߿8%߼0߱('ߦ؏ %߲ (!@ %ߥ8%ߦ ּ@@%߰@߱(@ ߲H߿8%߼0߱('  %߿8߿8߼0''0< $!0!!0($  %@!@%C(c8`% %(% $'@"@8%߲8%߲82߿(߼ %߰0߱'`@ % $@%x %$߰0  $߿(%߼ ߱'`ߦ؏ %߲ (!D %@(%0% x$߰0߱@ ߲8߿(%߼ ߱'`  %߿(߿(߼ '`'8< ($! !!40$ |%@!@%C(c@`% %(% $'@"@@%߲@ %)߲@ 3 ߿0߼(%߰8߱ 'p@ % $@%x %$߰8  $߿0%߼(߱ 'pߦ؏ %߲ (!H %@0%8%ߥ H$߰8߱ @ ߲@߿0%߼(߱ 'p  %߿0߿0߼('p< '%0(!\8%0% ۄ4߿߼'0'@h`< $!P%!!H%' p%%x%% 4'@@%X2R+ (%$ %'$B!H!c$@# $5JAP$5J  =$ 8$0C`0I 0J@ %$c`f`%0I$ A$ %J @ 2c` @@'L'90%(% % lI@ @'9 % 4߰߼߱h@%߲X߿x߳ߴpߵ`'@%@8%'' %2i'9`$$5)@"$ 是$  "X@ CB@Cp@ %) ߼߰߱h߿x߳$ߴpߵ`'@'9p q(%D!$D  | |P @ %ߢP|iIb@ %(%'9`'2g 4@r$ PߢP< '$c#!%d0%%H%@% l4'߿߼'@'< ($!P!! $ ' 0$ 4 4'@߿0$߼('p $߼(ߣ߿ ߡAߥ_0pE߿0dD 'pb%< '$c#!%l0%%H%@% ܬ4'߿߼'@'`0H< P$!P@!!P% '`H%X%@%8 40ߨH@>@%D1p8%$ߢ80 ߦ@h BX@C8% ߿X߼P߰`߱0'B@Cd E "  &0@'9 % 4(%߿X߼P߰`߱0'߿X߼P߰`߱0'< '$c#!%t0%%H%@% 4'߿߼'@< '$!!!P%0 '  %H%% 4@%@"߿ F߼ ߼q ߼ ߼߿%߰ ߱'`߼%߰ ߱'`߿߼߰ ߱'`'(< (($B08%% 6"! %\`$(%@D 8%@(% %0%$ ۄ%@p!&R2(%߼8߰0߱(߲߿߳%ߴߵ '`߼8߰0߱(߲߿߳$ߴߵ '`X %x0%$ $@߿߼8$߰0߱('`P%'$< ($B@0(%% 5"!B,($@%$`g0% % ּ%@!&s3$ߵߴ@P%߳x % @(%߿߼(%߰0߱ '`߼(߰0߱ ߿߳$ߴߵ'`X %x0%$ $X߿߼($߰0߱ '` %$0% |߿@@P%߰0$߼(߱ '`'p$(< $c0% %% #!@,H %0% |$@%@߿@I)) Ïh Ay(P!$,l*`%*& ߲P1i h߲PHh! pCQ! ߱( (AH(߱($!$B$c@0%%5 %) %̀$A$!A  A$!A$S$A$!A  A$!A$̀ጁ(%(  j%Jj߱( % \߲P@ %$8%0% ּ@J߿@ߩ %J@߼ ߰0ߵH$߶߷'9 %( (%@%@߿@ߣ`%{߼ ߰0 %߱(ߵH߶߷'0%, %0% |$@H H@@% %$@8%0% ּH@ ߿@ %) \ ߼ ߰0$߶߷'x %@(% ߵH߼ ߿@߰0%߶߷' @ %$ @%6߿@X`!! 8 $@%@ % (% 0ߦ %& `%߳`߬8ߧ߿@&ߴX H$@%߿@X %x0%$@ $X߼ ߿@߰0$߶߷'  %p߿@  %߿@  %߿@%#C#j%Jj) I) (%B('< $!!!| %%% (%*B@T %'|@%'% $O@߿߼߰$߲߱'X %x 0%$ $x߼߿߰$߲߱'$H% %0% 8%@%H%P%ߥ 4'@8%$ x@@X%1-- $! `` `! $ B%ߤ (%߼߿߰%߲߱'$CX %x 0%$ $߼߿߰$߲߱'$ ȈX %x 0%$ $߼߿߰$߲߱'$ IӏX %x 0%$ $߼߿߰$߲߱'$ Ii0%$ JfX %x 0%$ $߼߿߰$߲߱'$ I_0%$ J\X %x 0%$ $߼߿߰$߲߱'$ IX %x 0%$ $߼߿߰$߲߱'$ IX %x 0%$ $߼߿߰$߲߱'$ IsX %x 0%$ $߼߿߰$߲߱'IX %x 0%$ $߼߿߰$߲߱'$ ߼߿߰%߲߱'$ ߼߿߰%߲߱' 8(%!Cp$ 8(%@'9@8%ߥp % |ߦ@@%@&A !0! & 4 %@ߤ (%߼߿߰%߲߱'p$ 8(%@'9@8%ߥp % |ߦ@|ߧpGF(%D (%D(%܏xߤ@%'0ߦ 2$@߼߿߰$߲߱'p$ 8(%@'9@8%ߥp % |ߦ@o@%Îp $ߧp@%@%ߦ8%'ߤ$ 2(􏙌 %','( % @ %@H%@߼߿߰%߲߱'pJZߤp' 4@F 1) *ߪpJJ($A$Q$A` % 1h$@0%h % ߥ@@%ߩh#$c`E#߼߿߰ %߲߱'p % xߥ@㏙̏ 4'@z߼pI"xߤp' 4@oI )1) )ߪpJJ($A$Q$A % 1h$@0% % ߥ@@%ߩ#$c`#߼߿߰ %߲߱'p % xߥx@㏙̏ 4'@=߼Ԍ'@$ %H%ߤ'('@ߨ 2' ߤp$&% 4ߩp* "0A !0! ߣp@ 4&@߼߿߰%߲߱'cc($ i$Eߤ 1$߼ߤ -߼ @ %߼(0I A h %| ( %؏x@ %$ 2H$߼߿߰$߲߱'ߧ`s0%X % ߥ@U@%ߩ`) ߡX*%J@*߼߿߰ %߲߱''0 4@K '0k %& 1k 4 @@ߢ%,@%0!$ % ּ@ &Rߩ(%)*H* ,ߢ$ߢ߼߿߲߰߱'߼߿߰$߲߱'#QQߤ $߼uEߣpf߼߿߰$߲߱'߼߿߰$߲߱'|&|*) 0%$ 8(%$ 8(%x ߤ߼ ߤh߼ ߤXv߼ t|Ռ'@8p%%Hx%@1P% %0z@% %(%@0% '$ $ '8X( 45@%߿X2A T$@i % (%0%'' '' 6GߵH@߿X߲P߰@߱8߶('ߣ0T߰@߱8߲P$ߵH߶('@@ʯY' $D@%`\߿X@'9 hB R @0%A`߿Xt0`0߰@0!% @'9h 4(%ߦh߿X߰@$߱8$$4BC$߲PߵH%$!߶('XTT0L % '@ %x( % `ߤ`p '0%`%@}$`z$x%F & `!R΀A #kߡ L񏙂Dh  %@ߦh0%ߴp߳x߲R ߴp@T߳xY0@ % (% '@% )߿X@'9 hߡB R !@0%wA߱8߲P%ߵH߶('`Cx`x %@%x 0%$ $߰@߱8߿X߲P$ߵH߶('XF x %0% $߰@߱8߿X߲P$ߵH߶('x %@%x 0%$p $X߰@߱8߿X߲P$ߵH߶(' $4@%@%@ % 3(%߫u  %@%x 0%$ $߰@߱8߿X߲P$ߵH߶(''0< @$!P(!!88H% 4'$CV߿H$( %% %$&1@ߤ ߪ0'9ߩ(@%8%0% l߼@߰8߿H߲߱ߴ'A&R B&R@C&R` E&R A&R B&R@C$)eԏ@ߪ0ߩ(@ @'9@%&'ߤ 0% l߼@߰84$)_߿H߱ߴ߲'$߼@߰8''< 0$!(!!8 8 4'$C߿8$߼0'pߤߪ@ߩߧ('9ߦ @% l߿8߼0'p< '$!@%!!-%0B@@)  *$ % 2H %ߧߨg߿ $ %$ 2H %߿   $!("  %$ 2H %߿ ߼߰'P䏉؏$ߤ 2H'菉ߨ߿ ꌅ'(< @($B08%% |"!bT@sC`p (%P$:$@&R19$8%(%` %P%@%%@0%.& lH @F!&p7(% 8%F@ %-(%$$$ $ $$TꐅD@+h%p%.%MH+ đ.1$@ %߼8߰ ߱(߲߳@߿ߴ0%ߵ߶'p߼8߰ ߱(߲߳@߿ߴ0ߵ߶'p߼8%߳@ߴ0'pX` %x0%$ $@߿߼8$߳@ߴ0'p'08@(< X($BH %%$:%P$$ "!@ &A4R$8%0%(%` %P%%$I& lCH @@*m $ 8(%@%` %@(%0%'P%$ '@$ 4%@j&D0U* P4 6&RbT %@&1C`@*@I@(%$$$ $ $$Tꐅ@+%h%$BH+ MA4$@` %'$0% ּ%T@ĎbT߼P߰߱(߲@߳Xߴ ߵH߿߶$߷0߾8'CH$cC %߼P߰߱(߲@߳Xߴ ߵH߿߶%߷0߾8'߼P߰߱(߲@߳Xߴ ߵH߿߶$߷0߾8'߼P߰߱(߲@߳Xߴ ߵH߿߶߷0߾8''8@(< X$BH%P%%0 #"!(%D 8%8@(% % 4'$b#&s߿0C2hX2!( `%$(`u&R@@%;&։X %x@0%$߷8 $߼P߿0߲X$߳H߾@'h&sj&s@a&s c&s` h&sj&s@a$)#$ %@0%8%@%H%P% l%@)5(% $ 8%@%(%$ 8%E&1@%& %@%D&R %&G@0%@ %@%`H%P%% lP$)@٢h߼P߰߱ ߲X߳Hߴߵ(߿0߶$߷8߾@'߼P߰߱ ߲X߳Hߴߵ(߿0߶%߷8߾@'߼P߲X߳H$߷8߾@''(%%0A  %$(  %߰ ߱%߲߳('p߫2j4A @%a%J`&j&@ ߣ%&`&@&` & &`&@$)atߣ%+X'$$` *XߢC$cC،B@`80I2@802@ߢ،B6 @T 2@%D Cp$`Y@%`8%@0% (% D@@%%ߪ߿0ߡ@ߴ8ߴ߿0%kߴ8  8'߿0߲ߪ߳(CK$$cCpX$K߰ ܮ"X߱%ߵ'p%D A0$ Y@%`8%@0% (% D@@%ߪ%02@0 4'@(%'0# <$߳菿r#!$`߿0&sy' $ $A@@@@ ߿@@@'$s'%$ -(0#% 0* @%x'00% $8߿0%߰('`$ '& ߩ $$-+ߤjA4䏙D8ߥ %d߿0@ߧ8xP%'0xߤ0%$pߨ $X߿0%߰('`ߢB@CgB@@%x'00%ߤ $߿0%߰('`߰('`8%'% %% !& %ߵ߿߱'0< 'PP$!z08!!@H% L%' %G$B$F0&$$@,$A hV& 4b x`p@%@$@x` &` ` %|#c34B^$4B0H $$qC$ 4'@m@%0 1j%J@sj &0C&%` $ ( V@ %0%8% %0A Ϗ%$c`Ƭdnb @|Y | Hx@0%@%IX@ %(%%) $4!`k' 4%@@@%P 0C` %%J@E $&H$ ߮ `JP$ !(#I` %(%0%ߧ@ߩ8 %  % bX@AB@A0@px`h 4L߰`ߵh߶p߾x߷ % ߲߿P߱߳XߴH'cd @|Y |  %|KUH %  %'  %ꎢ '0%0 %"@߱0`0 @   4  %߿߰'0#`䏙⏙$  4  %߿' %(%% h%'P0%'H %@@% H%߲ ߷ %'hߦ8% ߱߿(߰ '` %'` 0%'X @%$'(%$t $3((@(%  $߿'< $BoP"! t< '$Bo "!t%  E%(&3(@A18B@0 $@Q߿0C^ߩߡ ABA I@$@!%(3H'$H$ %# '3#$%) 3'$(%( $ *߼&#߾߾߱ߵ('`@0@'9`0 (߿0< '$Bm"!t m%%J3(DX%AB8%%  H# H7 X%߼߷'00@ )B($(!00'f$0$( ('Bj!bE$b0B$J!A`'#$AC&*H!e 00!@"%@%$$$ $ $ )@-h$%)``%$-`%(!E`Ff ߿߼߷'0@'9` ߿0< '$Bk "!3($% $($  ߿$߼' %߼' < '$Bk "!t g%' (0##&3( &3(߱e$0$&&  %8ߨ&& (% $@%AH߿0 7H@4@$P$31 )߿0@'߿0'Bp!f80$%s0+ cg$4&30 g$4Ø `&&R $ @%@H@ %'(% G׮3߿0ߵ@ߴH߳P߼߰(%߲߱8'p@'9`0 ߿0 %(%  $ߢ ߿0߼߰('p< ' $!i!! 8($@ @%@%@$B H C&$cC(% 3plhd`\XTP$L$H %|xt&(% 3@% 􏙌 HE8%$E0% %'Ҡ @| l %|$P 08PH$@&%'e $\@%$4@ @%U@ QAf Fd@ Dd@D@0@,@(@$ c`&sefa  ӏtx $@ώB TBVߵ8߲(ߴP߶H߳@, < % \ % :t %8$x'Ҩ % |$8 %x$'Ҩ |$d %H%x$q0% l$ȏxxt$ct at%t:t$ctqtg߱߳ @%߿H 1'HȏtH 1'HՏt' (< $c'#!%$4B $! ߼߿(ߩ ߨHI_߿D ߾'P< '$!& 8%% !!  8% ߼'0 ߣ % bߩ) ߿ߢA$#$A  % ߩ߿)< '$!%!!  $߿߼' '0< $B%"!$x %%( 1h$$hD$D0@%@%`%4߳(@ ߤ 1h@(%@%$@@8%0%I (% %%) ּIa$! -a߳(#$c`##߼߿ ߰߱0߲'`􏐌  <$x0% %߳( Ռ$h1Ώ< %$x'(0% Ռ$x % %߼` % %߳(@$0%`(% ּ %߳('H@80( < $!#!!%'' 4$&0$&$' <%& % ߷@%߰' 8ߴ߿߼ %߱'PT< '$B""!% T߼߿ߣT߾'0T< '$B""!% T߼߿ߣT߾'0LL4!'h< !H$B" '"!h%  8ߡhЌ" 4$#!׈ ߷߾q!. ߱ߧ8x@ߦht$@%&1 %@ *􏅀x %@%@ $Hߥh  %$F (F 0 ߧh߮hADF p<p>D F! F!F!!ߦX߫hxh  %j,H%@%k8@ $Xߴ߬hx %,`H%$\(@%X PnX#$0 XMP#@ PߪhJ߿@H߳@%x@0% %TH@%$G@ H%:߿% ߵ %'x@ @%t,`0% %'P'`'P'p 'P'hx'P'Xx$8?X bp %(1118P @%H 'P@ @ &s %x&@%@ $X߿߳߰ߦh(ߵJߴЏxߧh %@%4@ $h߮h(%=߿%t $% $߮h(&snp*)&߰hDx! `0% % @%'Ԁ 'Ԉ$@ IP!@ %J 8%Ꮔxx %@%@ $߮hx %@%@ $߮h߿ߵ߶ߴ߰߮X ߳ߢPߡ` %"+  %'Ԑ@ @%(%ߤh (%ߣPP!+` %߿߶߼H߲߰߱'x %@%ߦX@ $ ߰h߿X߮XT%P%L(%$6$F?&!< f< f?'C F<F?&i!I n< n?px&sP%@% %߯p@%'ԘH!X!p&%kp#x1%)p&$ (p#ߧx'Ԡ@ 0 ߥp߮Xߧx$6$  F< &vp%@%@% 'vp%`%`% &vp%@%@%banm &svpp%h%xh%ߣX߿`ߴߴXp&p#1߷p&߿p#ߵߴ %'x@ @%߿߰`߷ߵߨhߡXX%T% L߶X$ߵ`$&# %x0%@%@ $ Hߨߥh$F 0%8*  %0 (! %'x@ @%&߮ߨߧRߥ * N< N?%1i! N<$ N?!6 v<v?$*  %'Ԑ@ @%(%ߤh (%ߵ`P!#*@ %  %vp%"H%.H% $vp%"H%.H% $vp%b%n%߷߾ߵ߿ߴ߳ߣP+` %'Ԑ@ @%(%ߤh (%ߤPP! + %߿߼H߲߰߱߶' %%P%߿``%%@߲0%x%߰% %``%@%P%@x%߲H%߰ 8% %`@%@%@%߿ׄ`߼H'߾߳(%#N+ p+! $B'! A8!.8 %'`@ X<0< $`('!0#xtx@!$ X8'! % x%`p$$h@%$hF0!$"ߧ83ߧ8St % 'Ԩ&RB*`& $ $ߧX$ &$ߦX4$6/$ 7G(ߧXG8! LF R @%$ 8%߱@8%i%$ 3$ Ssat&@*1P %$$dbI!$!E %ߦXF0! LF R @%$ %0%0%$#Zߧ83W$ 'SUt % 'Ԩ$ G8!$%t$ 3߱@S߱@st߱@&@*1% %$$db!$! %t %'Ը 0% %#`>tx %0% $ t %'Ը 0%p %(9tx %0% $ ߧ8tx %8! $ hZߧ8tx %8! $ ht % 'x߼߰p߱h߲߳(ߴxߵ߿ ߶߷`߾0'tx %0% $ Џ  %$( &%tx %0% $ Џ  %$( &%ߤ(%@(H !' 8t@% %'԰ ߦH$( (* %0  (%ߤ(%@(P !' 8t@% %'԰ ߦP$( (* %0  (%ptx(% $ x߼߰p߱h߲߳(ߴxߵ߿ ߶߷`߾0'tx(% $ x߼߰p߱h߲߳(ߴxߵ߿ ߶߷`߾0''(< $!!!%%d%8t' %0 %ߢ@%B@. %`, %@HX$ P$ $ F $"' %&F*&R`" %&*.$ 2$  % %' %&߷XߵP߾H߶@ %'% ߲0߼߰߿(߱߳ ߴ8' %' %& %' %& %' %& %' %& %' %&t % '߼߿(߰߱߳ ''< $!$B %"! ߼ ߾'0$ 0 %߿@' $< $! @%,[!!(8@H0|% F!  %!߿"$B&@"$cd $ 뎁 莁 %$ ߱(߰Hߴ@߳8߲0H(H7#%߷$!&    & ߱(߰H %% ߷߿߼ߵ ߶'`ۏ'( @H0P< ($$& 4! S#&,$&RW$3#&w$0!Q!8!7!8&1\  %@%@ %(%  0%&\<!$G\@b!$G\DB!$B\HL6#7!LT#!T߱%X2 ߳P(C%߿8#%!X(4ߴH߰ ߴH% ߳P@"!!0&0$B߰ $@ %&Gߵ@$!"A$!Ab@$A!"A$!A$a@P% @% @!$@%J*H!)(%(H,Hߵ@ % ߰ `%%$,A*&  &1 &R  "߱߰ ߿8߼(߲@ߧ߶0 ߷'p%ߵ@@!$@$A!H!)(%˭(< '$B"!|% c%@ % 8'(@% %@0% '4 %(%'' P0!@@@%%%@* d !$!&&s %߳؏%@ߴ%8*&  & ߴЏ,' ,ߵ$߿)߼%߲߰߱'xtA0'$Bt@ % \@ȏx$ %  <$ @tx $ $|H 1'㏢t % @(%߿< '$%!tx $!@߿߼' '< $B@"!%(% ' 3߼$('P|td`\XT$'ܯ'\'p'l'x߿h$P߾'@< '$!P!!% 4L$t@߿ h߿` x߿ ߿  ߿@ ߿߼߰'0' Px`@|(%ld0< 8$B"!@h'90h#X"#(#p % 0%@%2#HCx'8 8!A+A BU!$A  %$ w@%)"@0%%'e%18+G (++E +QH c@h%R@ !`P%d! # !%A+g 0 +!P D!̍p # !%o(+q  8+A D! # !%!+y @ +H D!nэ % %%`x%@%߲%h%@X%H@%߰ `%`H%x '(!.+( a0 !p+ nH T! 5"!A ߴ!. ߱߱ߴp$߳h&&1&s8$x$$!> ! ! ! $\J)$HI߹20!>(!G ߣX(!(!$\EFߦp CF D@%ߢ$(0,48!q!T!&\<!h %ߦh&D\@ߵ% xߦHr !M@'9(% %߶x ,&\T(#ߴ߱$߳1߲ ߵ   %߼8߰@߷(߿0߾` ߶P' %`%߰%%H %%`x% %@%߲@@%dߦ %@`%`x%`8%H@@%(%߲0%H%߰W%tx0%ߴ $!pʎ $\D% @r !$ !$\H0%% @(%#N+C p+!N $B&! A0!.0 C%' % (%%%%F%08@H%t!&1 &&*(&A ,0#&d(&s &%(&A 0#(%`(&1x% $!x% $!x% $"߾H߷@߰8߿0!߲߱!߳(ߴ ߵ߶'`C!'`8@ L0H%(%P`%p`$Xt%h !&΀I#&"@(C`&x@% $"8ߵX߱`߿hߴpp`X2a`P`%$% !΀& (`>& ChߵX߱`߿hߴpA`%T`0%@! $&HF@E(#($B"(&߱`pX2a`"X`%%`$ !΀ :&@(A &&$C !hߵX߱`߿hߴp%߰(߲P߳@߶8߷0'&΀& <@(A && :΀ @(C`$&& x@% $"΀x@% $"&>p΀(&΀& ( &&"x@% $"`΀x@% $"`&=%tx@%h $"{߿hx@%hH $"`ߢH+߿h'8 (0h(xX%0@HP%l0P%$]$$ `H%< $0$  +&! '0%)dp( 0V[8(|$$ \$ #$@$;% $ %k?$!3$߬0 x%p0$]?!3 x%'?%$e'p!-%x%.? ? P@߫x'?|߹߲߳ ߡhߵ(߶0$] ߱߫ߣk+$`?߳߭%h#'1$ `0%@ !!J'oX&+  %$K '@a pP%(%OH%)&k@@% !8% 0%%'&@% $A % "$`(%%G& % #( $` %"%G& % # $`(%!%'&@% C( %) %J+ّ! %/h&%M 'a `%-  %oX&K '-  h%o&Ch '@%c /&'! ' M߭ h! XoX!<k5nX$`K$;$   /!!.$ % '?jߣ#`P%$ ߳ ߭߳ h!$ߡ!4߭ߣ0`߭%JMh!%JY$ A4ߣ0`߭Mh#)`%0%'p߲$ߴxߨp'0ߧ $# %$  '0ߢh߼`߰ ߾߷߫(#߾@߬x߿Pd7߱8߷HP߰X'p)߲ ߴC$ kۏA߬p${#&'a` p%߫x߬kllߴD% (%0%8% 10ߨx߯x(Lp@%l%A+ m߫x%al$ ,cl$cclpp$߯x%ߡxD'8h%0%? %'97l0#'#? ' 18%ߡ0߬x'0 ߸9$2`$$ P!J1K`@%$ |'߬%$ #$߬xP%@2(`ꭀP'ߤ@ߥߦ'9G0ߧ ߨx'0hߴxߡd!ߡh $\|%߹$]0B߫0߯x+p`[l%A+ ߫x%al$ ,cl$ccl~ߦߨxDl %h'900#8#ߥ 2L8#ߣxߡ߿$ \|$ ##ad'0$ ߩ%L % 0'߿$ \$ #'0$ |ߩM!%KX+`ߡx%+l$c,l%,l^#l$c#ldl+l%k+lc,l%,l$ (x'jߣ%A+ ߫x%al$ ,cl$cclall%llal$!alb,cl$ccl~ߣ'#cd$ ]p$ Zx%$pl/ߡ0߬x%l$ cߣxallhk c Y,#k!7#ak`ߡ8YP%[$ js$߫t|$ Mh!&ߡh# hߤߣc$ "kv| (ߤ؏x@ %$ 2H$"'0$ h@ߤߦ'97 ߧ(%  ߨxߴxߡd'0h!ߡh V'p|%߹H 1ߤx߯x߸'0lH 1ߤx߯x߸'0mlߤߥ8ߦߨ$" ߩx'0h| h!ߣ$ ]kXx#߬0Xx#ߣMh!ߣ%Jj|$ K$ ]lXx#ߡ0 ߣXx#)=$ `0%$<h%ߧȏt'xߤ@ $" ߧ'0߸߫xkT`߭x߰X! hߡ!0!  c߯xH؍ߤߥ 8%ߪBP ߸@K`ߤߢآ߹$$9ߨxߧߦ (%h'0@(߸ߣh$ khD %ߥ$8% 10ߨx߬'0@%>ߪxJx`LP!JC k6߯xK`2 $ Lߤߡ߫"+NH.߮LЬ, b $#" c'0$cc؏ Tߤ@ '0ߤߥ '@ hߤ'0ߡ ߯xߪߣ (cp`l%KX+`ߣx%ll$ al߬$!al,%A+ ߬x%l$alߣ%klal%kl al%kl al%klc߫(`*X (ߡ%4@%$ |Mh!%&'$]0ߣ0`2H 1ߤx߯xlH 1ߤx߯x0l) ߧȑC$ kߧȑL${`& h ߣ0`P%e$ $ l߫H 1ߤx|ߩ$ \߯x$ #'0߿$ Yl| (ߤ؏x@ %$ 2H$"'0`$ߣxc߬(~!*a` (H 1ߤx߯x'0qlH 1ߤx߯x'0xlԏ 'Dߤ '@S'0$ЏDߤߥ0%8% 10ߨxߤxx( ! \߬t '0:|% ߹Dߤߥ$8% 10ߨx'0-0%ߡx߫(8d!a`*,X !y(@h%0% p%/& %A $kX `& %L %aa,X 0& %F %l,X o&# %fF%c0 %J%'p%@`%H%8h%0%(%%H%| $|f 0! %%0`%$@(% $ &0$0!0@ %&0$0 h$$ )0(`E&P/@'9G0 0%8%ߤ @@%@(%߿PTd$\$$ !&(4ߵH!ߵHB0C`3ߪ߫`ߵH#Pd߰(߱0V߲@߳8ߴ %ߵH߶'8 0%@H%@%ߤ $"@(%߿PV#߫@@ %(%'97  0%8%P@@%  ߵHTd@(%V߿P! hߤ$"#| (ߤ؏x@ %$ 2H$"߿P$ $| (ߤ؏x@ %$ 2H$"߿PP'`@hp%x$%%%@%ߩ|XPH$|XPH^(!0(%$$]05* 1)($C+`$l$#l$!lV*l%)l#l$!lR*l%)l4ߪߡߣ**2"aP ߩߣ%)$cߪ@$%P%!B0C` @%6H@&$p%ߪߩ ߪ@Xߥ(#s8q $ߩ %0H+$\@% D/@&&+`D$]$ߤ$@% 10(#@%ߤ8*l p$JP+@P$l$#l$!l4' % 0$ $ AP!@% % 0'$ i$\U!&ߡ@% $$ 2#`ߥP $T߱Pߴ0ߵH߶X߾@߳`P߲߳x#߰hd߿(X%߲߷p'D$8%ߤ 10@%@%ߤ8H 1 %lH 1 %5lv <!2#`Kߩ))$H$$ m߱&#a2@ lp$*H+ &1$lrl$!l3HCU Dl**@ߢlp$#+ Y$l$ *l%)l1ߢ߲߳xߪ߿(߱P߾@ߣߤ$ ߶X`= #ߵH߶Xߴ0XTd߰`P߰h߷p'$l2l$llp$#+ $l2&1l*!%Jl Slp$i+`&1 % 1%l % 1%l@%H߱ߵHߴ0XT߿(߱P߾@ % 1%lߤ(%`0%ߧ @%d߲@0!ߣRP!jH*%I !p'&$ % 1%ul4&ߤ$P`0%ߧ P@%d0!&1$ߡ߲ߣ z %RP!jH*I %p$%0 !%0&1 hߤ| (ߤ؏x@ %$ 2H$#8$ #P'xp%< $$B`%% %%X"!ߪX$$Q $[H߫x$\5k*&$ߣX%H`x'0ߦX $#P hߤp| (ߤp@ %$ 2H'0$ +Y&`($A2$` l p$aX+`F&1$ lRl$clsXCU`Hl*! ߢ؎lp$j+`.$l$a l%k lqߢ߼߶߾߲߱ߵߪߤ߳@ #߷߳߿$ X$  T߱dߴP߰ߴ'P 1%l$ lRl$llp$#+ $l2&1 l*!%k l slp$j+`&1 % % 1%l$X+`$l$ + l%J lCl$!l\+ l%J lCl$!l2ߣ߫P*$[j ߡ&ߣX$!RqQ*<Qڏ4`P%hq@&߫X@%QqLߣhߥ`(#߫h@P%<`: $ߡ` %4+@% s$@&R&JX+`D$$$ߤ$@%@ 10D(#@%ߤ*Al p$+`Q$l$ + l%J lR' % 0&RBU!D$8%ߤ` 10@%@%ߤ`ߥ`ߥ`ߪXQߥ` P$`߷ߵ߲߳߿߷ߵߣX߲߳`߿x'ߦX $#P hߤp| (ߤp@ %$ 2H'$ ߿' %$  0hu4!% % 1%l % 1%:l߷߿XT߲ߵߤp(%0%ߧx @%dߪ@t!6!AX*+P > % 1%Ύl % 1%lD'P(%0%8% 10@%@%(Bl@*p$+`A$l$ + l%J lQ&ߤp$P0%ߧ P@%d !$$ ]j&$C @%Aߪ6!AX*+P $+`$ l$Cl$!l^+ l%J lCl$!lZ+ l%J lQ % 1%l % 1%ߎl&ߢ߼$T߱߾߶P߫߶X#ߴ d%k X߰'P hߤp| (ߤp؏x@ %$ 2H$#8$ V'@X|p( H8`%0%%@$\$}P${$h$&&P8%!!1ߢh$ @d&,c'#  % 0h0!&&V&ߣh߲߿&ߡh`#*G @ %߳p &@X%@%ߢ@%+@mDJ hߤ| (ߤ؏x@ %$ 2H$#`ߧ߲$߿/#&AXT߰8߱(d߲``%߳Xߴ@ߵ ߶P߷0߾H'$C+`$Gl$l$!lN)l$ll$!lJ)l$lߩ &AXӯTU!T!+ "&$ &&ax@ 0'(!%(% % ߫x$c(g$$$BU!D@%$$(#` % 10߶@% ߿D@%ߤ8%$&E 10߳p@%߿*l p$A+ $Gll$cltP$ Y߿T߱(߲`߳Xߴ@ߵ ߶Pߡ߷0#߰8d%$!X߾H'H 1 %l߿H 1 %lu߿@ 0'4!߫x&'`$ `%x% p%$@%< ${$c΀(%%%@%8 P%(%%0$_%@0%#!P%q@#&$DP!J1J@@%$:$:&*$ }&"M%%@! (%%H@%$$B$h!%X+ %$:(%`H@PϏH8(D-#$!$BM @A(Ch$B$D$uߨUPXߨ`PH!ߴP%$* %8% % 10ߧ߫ߪj(K@%l$ `p$+ ߪ$Al$ +Cl$cClaKl%kKlcAl$!AlZ+Cl$cCl~$@%8$)`0%ߢP&@ %@H% LP߳ЏHsd߬@%߿`p!߳P@E&ߧЌlpaP>!ߡߤ 1%ߦ߿`lߡ$+l$ j` h@ %| (@ %؏x@ %$ 2H$#x$߿`߼P#߰ ߲߱@߳0%ߴ(ߵ߫߶8`X`TjdwP߷~߾'7\(Yh$$0%$H$h$( $h $H$Qh$$!!0!@ 0%PhDX$$'`8% 10ߨЏD߸X߿`߬hߧߩP(Cl`p$P+@"H,H$X+`Hߣ$kl$ jal$!al"$$p%HH 1ߤЏHDߢH߸X߿`߬hߦߩPlH 1ߤЏHDߢH߸X߿`߬hߦߩPl߫$cl$ajl%JjlCal$!alT*cl$ccl ajl%JjlʡB^`ߨЏ`$8! %% 108%ߪߧСS߿`(Jl@%@5p$X+`߫ЏH 1ߤߦ߿`l߫$cl$ajl%JjlCal$!alT*cl$ccl ajl%JjlRߦЌplFߡЏH 1ߤߦ߿`lߡ$$+l$ j$+` ߫$cl$ajl%JjlRH 1ߤߦ߿`lDXH8%'900%% % 0 @%@>߿`ߧ*Al %p$P+@߫ߤ 1%ߦ߿`l߫$cl$ ajl%JjlCal$!alT*cl$ccl ajl%JjlR%$P+@ ߡ$*l$ C+l%k+lrߤ 1%ߦ߿`lߨߥD8!$ % 108%ߪߧСS߿`(Jl@%@p$X+`>ߣ$kl$ jal$!al^+jl%Jjl Akl%kklRjal$!al2$+ ߫ߤ 1%ߦ߿`l߫$cl$ajl%JjlRߦЌplFߡߤ 1%ߦ߿`lߡ$$+l$ ^jߤ 1%ߦ߿`l`XDߵX'908%0% 0  %@@%$ $+ ߫ЏH 1ߤߦ$ l߫$al,jl%Jjl^H 1ߤߦ$ ܌lߥD8!ؐ$ %8% 10ߨߧ߫ߪj(J@%l$ @p$+ -ߪ$Al$ +Cl$cClaKl%kKlcAl$!AlZ+Cl$cCl~$+`߫ЏH 1ߤߦ$ l߫$al,jl%Jjl^$H 1ߤߦ$ ͌lx8%'$d$# @*$d 0 @ %$  '߿`*j@$X+` ߣ$kl$ jal$!al3ߤ 1%ߦ߿`l$P+@߫ߤ 1%ߦ߿`l߫$cl$ajl%JjlCal$!alT*cl$ccl ajl%JjlS'P%< % $!@$ !!%%(%$%||(@!80 'D'9 %@ 0x(%dߡߢ8Q!|$ $2߿@E(!߳0 h` %| (` %؏x@ %$ 2H$#$$߿@@P%@lp$AH@ 1 %l߿@$Al$ A)߼ Q#d߲߰߱`%߳(''0(< %8'޿ '>!$%D%%%'9%$% 2xPD` % (%'9@0%8% 2'@%$$ߪ@#%$߶@3߳%ߵ i!c߲q#߱$c$d %J D'9ΰ' 3P߼8߰߿%ߴ0߷(߾'` % h߶| (` %؏x@ %$߳ 2H$#$@$dH%ߵ ߱$߲ߵ  ߡ@$$߶]ߡ $߶D$B'9*(% $ 3 lp%ii+@%`c@%%el$El$clbl$!l?l'9l8l%lp hp# p l`!mX#DJ@%'9K8%` %@%F .߶ߪ@%ߩ$@2I$Akx'@f $$ ` %$  '@_$BI$ {*ߣ``H%`#)@X#` @8%|$)$( !!&$$B߶H 1 % lhls#߳P UP# P(" ߢ*H!*j#D# ߡ(! l p%c+`+%cl$a lߩ%J lI l p+@%8%D0%$' %k l$  10jx( !@% \߫t`j * l p%a+ %j l$ Il$clw%a+ %cl$a l%J lNIl$cl a l%J lJIl$clw\'(%߷ %$. 4 ߩli! h)#ߩ$ *h%P! hߤ| (ߤ؏x@ %$ 2H$%߱$3y!%P!JFfMh%%`%% %@%`%ܑ%Uߪߩ&*H!&5&߬8D%k'9h* %߳@X (% 3``k߱HD%&0 %(%$$ @% 0 %ߩ.J&RJH S %(%$$ @% 0 %ߤ@%% $pRSߩ`\I@߬p߫ߪ%P`%KP!+X߷߲߳߶߱$ߵ8@ % %߷߲߳߶߱$ߵ8v   ߤ$߯ߩX߫Pߪ&%kP'&j% &$`Sߴߵ߲%U!Ԡ!q!%s&R&1 ` %@(%` %$$ߨH 0 %UBӏ߳@D߰8LD8%$ƈPߤp 4$`ah$$@`%$s!@%߱H$&s4P$)iH+ K$) l6 l% l^ l%J lLI l% lZ l%J lQ plA) %&R$+ l&1T3uߤ$ߦߧ(!@%`%$    P@@%߰8ߪ *)lLX*pP  $)iH+ $+ lw l%J lաQ 1%Վl % 1%l % 1%l@H߬8lp$5߷`+߶{ߵ8$2l$CQlߩh&l l%l l%kl qlߡ`%JlIA#hl`!aX#lp$**H+ [$%l$Dl$clsl$BlPl$!l1\l'`߸h$'l 4 %߱($ߧq!(!st`Dh@%'9lߤ&fRP!+H# .I@%@-t߳$ ߲Ie߾@xߦ'p $%Џ$ߤ  'pW߷߲߳߶ߵ8߱߾@ND&0ߵ8%߷߶ 1 %l % 1%lhl2!)`#`#, lp߫sP*!j ߣ8$)il$!wuhal!5#$x#װ*cp#$*jP+@߬8$*l$ #Il%klVjl%)l\+l%JlJIl%kltߩ8`&l %)h$$d'`0# 40#@ߡ8)2H!#$c#!h$w#5!$!#J)d,^+$ #*߷ߵ8Dh8%0%(%'Pl߶@%rX!LP# 10j(Ll@% p$)iH+ h$+ltl߾@%JlR$,l`+a$+l$ jl%)l>l%l\l%JlJIl'l߾@߲.l ߳߷߲߳߶ߵ8߱߾@ hߤ߷߲߳ ߶$ "ߵ8*4߾@| (ߤ؏x@ %$ 2H$"߱$}ߤ8 1%ߡ8]!l$)iH+ (߫8$)il$ ",jl%JjlhT % 1%7l#$ "* % 1%l % 1%l| (ߤ؏x@ %$ 2H$"ߤ8 1%ߡ8ӌ!l(%      䬠'08@< $!H!!(%&d %R%E %q!@%"%@;  %)f`%@%AaAaA a Aa$B$cDA`@% (%@8%   Q%&& &dr`!@H%Q  @%2#@ % P%` X c%$`%߼ ߲߰߱@߳8ߴ0߿(ߵ߶H%߷'``@%@ %  ͭ'< $!%!!( %!   %&V ߵ(ߴ  %  %߿߼߰߱'@P'hXp%< '$!%!!%%P%%%%P 4H%PH 4H'D`& % (% 0x%!d0!$ P|$ h %ߵp߲h߷X| ( %؏x@ %$ߴ 2H$%$ !H!)*%D %(%@0%'98%$"P -, @%@@%ߵp$߲hA߷XX' 4|ߴX 4|'߼#߰3߳߾"dߣP߿Ю#P߱%߶'P#d*A*p!jH* I \@H%$G$1x %0! 4$ % (% 0x%*dP!|P$ $x'`ߦ $&@ߵp߲h߷X h %| ( %@ %$'` 2Hߴ$ !H!)*揙$ tiD %(%'9@0%8% . @%@@%ߵp$߲hA߷Xߵpx'߲h߷X $& %$  'X#d*A*p!jH* yI \ߧx(% %$H9 40!`ߧ)h&l(! %$x0# 40#@ߡAP!I%)I % (% 0x%#dp!P$ $|C!BI@(% $eAL$$ e *TD %(%'9@0%8% . @%@%@y߷X$ߵpA߲h$`ߴߩ`Hߴߵpߪ߲h@6߷XߡH 4Xߣ`1X@-@ %IT 4P'Cߵpx %$߲h߷X  $& X %$ '0@gD&!$ #$T 4P' %$ '8@ߥ&j|k$ %$ '@@D&q|r$|C!BI$ JߴHߪx Xߨ`ߣ*H!((cl`! p% +X+`%  l$ jlߡ$cl/a ߣ(c`m% *P+@%  l$ $b Cl߫$!lk+%!+ %l$ + lߣ%J lA l%k lTjl$!lZ+ l%J lC!&ߤp!D$C(%8%@@% 10ߡ߫+(Jl@%@ p% *P+@ҏH%l$a lP%k lb% *P+@ʏH%  l$ jl$cla l%k lTjl$cl a lP%k lb$%!+ h%l$$ bX + lߣ%J lA l%k lTjl$!lZ+ l%J lC(u$$ "P %  lj%#+`y%l$ $B a lߪ%k l cl$!l \+l$cl a l%k lɡjߤ$ V!(s$$ bX %l+(r$ $ "P %  ljH 1 %'lH 1 %BlHH 1 %l,ߢHHH 1 %lߢHԏ' ߴHDߤx '@ߡhDX0%ߤx8%$h 10@%x( ! \8߫8ta jHH 1 %lߢHHH 1 %lSߢHHH 1 %lߢH@ 1 %l*ߢ@@ 1 %l2ߢ@Dߤx$8%X 10@%菙HH 1 %lߢHHH 1 %lߢH'h< %$Bk %"!%%D$!%Pa*'9%pb (% 3hlD0e#0#'90(% ! 0x@ %d2!|$$q߿h|&0!w$ ")*$D@%8%'9`0% (%ߤ$  -, P@(%@%$@߿hT߳߼2#߲߱߳ߴdߩp P$B߰%ߵ'$\' d$ % 4Q!D'9 % 0x(%d1!q$ $|$ !6ߧߤ߯ h@%Dp`0% p# l'9p (%`!mX# .@%@1߿h$A߳xߦ' $($ߤ  '߿hx$ߤ  $(߿h|"߳C!B$ Iߤ h߳| (ߤ؏x@ %$ 2H$(p$߿hhlߪ (#d*H!! (#% l p*P q!%x$ l$ Iߦhlf!c#X$x#p4*P` #$+ $l$#a l%J lNIl$cl a l%J lJIl$clt` hl %$'0# 40#@ߪ ߣP*H!%ߪ`$%ߩXh$C#(!@t$RL$# hD߮@%8% 0%(% l'P`!mX# 10p(Al@% ߿h$+`W$l$ * l%) l4$+`Q$ l$#l$!lV* l%) l#l$!lR* l%) l4ߴx$.q* $|"C!B$ I䏙D'9 % 0x(%d!q7߿h$9߳H 1 %ol$+ $ l$ "Il$clztH 1 %lF߿h$"H 1 %l߿hH 1 %l߿hH 1 %ݎlP\' H8(%x%%D%0%(%`'9$%  0x %0d!$|P$ C!BI${ 2Ah %@(% 08%D$\P@%$p(#$$"bpH+ %$[@DH!$BU"@%#?h"*D (%>l%J*'9J*$XAP # 3*+l!p%c#+@H% P@%i)l$E('l$'l6%l$%l$#l$c#l a?l'?l-h#,+l`!mX#L @%8%j&f(%` % @pߡpa3#h*l~!aCP#AP#j @}߳ߪXߩ@#h*%i!#l@ @%8%@0%'94P(% %$   +P>ߴ(?d@%߷8!@X߿0% ߶`)h&l %$'0#߶ 40#@ ߿0ߩP !i##!*%J*P#߰ߵx>߾*dߡߣ #`!PߢH"\߱@%߲'h8%@(%&h % 0߶I @%$ }JDߴ( % h߶| ( %؏x@ %$߷8 2H$($߿0`%߳߳H 1 %@+l[ߢ)p+l+4%a!l$ *D%4%#\`߳)` ߪX*p+lK(\'(% %%l,l$ F 4!l#)h~!)#saL` @%8%0%ߥh % @ߴ(߷8ߩ` @%߿0&>H 1 %+l߿0H 1 %Ԏ+lP'0h`H%X`%h%x%@%H%%P%%p%%%|$|E(!0($_$ @$ (0&B P@%@ %@(%'9G00%8%  @%@%߿$\`5"dR!$BBAߣ$ <|<$(!PP+@@@ @%8%$ ,P'94P0%(% %  ߰@%@߿!p$l$$H 1 %$l߿$+l$ j#d7t!#0d߲߰x`%߳pߴ`߶h7߷P߾Xߵ5P߱Hߵ@'D !$  h %A$"#| ( %؏x@ %$ 2H$"߿$ ($߫( ߡ  #T`:ߩ4 @%ߥ$ %8$5%& P P+0߫߿@%@u1E&!!0!@ o@%PFP!J1J@@&}~$ %8@(%0% H%@% $"@%`߿+p$ldSߡ0$*l$ Cߴ7߫k$ aߡ Uߣ8% 0%@(% % 8ߩBH ߿ ߤ! 5ߨ8mߣ`kD % @%8%$ 10(#߫8 ߿(J@%%p$@9$l$+ fH$*lU#l$c#lHt| ( %؏x@ %$ 2H$"k߿H 1 %$l߿$0$(%9 %% @%8% 0%@% +@߿4d$7!$+ 5H$#l$a+l%k+lVj#l$c#l a+l%k+lRj#l$c#lt$l*p$KP+@$ % 1%$l߿$*l$C!l$$!!l%5H % 1%$l߿H % 1%$l߿'(H08%@%% '$US!%&sa iijQ􏙁 %&e  0%T@&߰0߱8߲H߳߿%ߴߵ߶@'ߴߡ(ߵ߳ ߳߿ߴߵ&$ V@%Bߪ . @߿SSCsS`i` vq`j3! S&sS߳߰0߱8߲H%߶@' 0%(% &d߿| @!1$ $  8% $ @!1 #dK$$ $'< $cW(An%(Ga #!(Fo$rG(Cv$ 0 %- 0(Ab E(Gf$ #@qBb!c0c$1)`d 0"!!0!0!$ 0b!$Hc$ 'H!%)0c1)#P H  %  %߼߰'@(G (A  $ $ E%%P#$ ` (Fw$x$  (Ag $ (Ct` (Fu$ $bG$ A$ C80!0ߤ$'  $߿0I_P#߿ H%$ $ $ \$ x$ '0(< $!U@ !!%8%% %$&,cC +@% HHߩ @@%DTp*"|JP*@2D#xHi!s߼a߿8$!aߴ03|ߵ&s3|@%߱ %@߳HP ߳H߰(߲@'9L'(%@ &$@@%P ߲@  %߼%߰(߿8߱ ߴ0ߵ''9P 1 %ˎ"|ď  %* &@ %0%(% ba0! 'l< ($Sp %p%!h8# # ! @ % 0% ht߿ h߿߼($tߣߡh#!p1!l߰ ߱'@'| % !  @ %`0% x߳ ߿ x߿$ߢߣx߰ '@'0 %(%%% !* t"*` @%߱ !IH* -߱$ ߰ ߲(߳0'`tx (%8 $)߿88 !@ߦ@ % 1߿8 ߿8$ߥߩ)H!ˮ tx8 $)0ߨ߿8 !'%%! * t"P*@A߰$߱ߣ !ߨ'P tx(% $)߿ tx(% $)p߿ $ $($'%%%D0$6&0!>$]$"$ {%qh% % (%0% 08%@%$;Q@%a#z%&0 $ $ ]%%EA %+F&!4IG H8!C$cC %' 0x%dp!|$0’$$"߲߰߱߳ߴߵ߿߶%߷߾'@! ` % ` %ߤȎE@% ߦE` % ߦA  D DE$GSߦߣC Fh% % (%0% 08%@%$ }Qv@%b";$;" %c$}g&u%&uh% % (%0% 08%@%$ "QA@%b"W$;"<%c$"g9}&u hߤ| (ߤ؏x@ %$ 2H$)߲߰߱߳ߴߵ߿߶$߷߾'@`%a&p hߤ| (ߤ؏x@ %$ 2H$* ߲߰߱߳ߴߵ߿߶$߷߾'@ hߤ| (ߤ؏x@ %$ 2H$)߲߰߱߳ߴߵ߿߶$߷߾'@`%,&p hߤ| (ߤ؏x@ %$ 2H$#`߲߰߱߳ߴߵ߿߶$߷߾'@' %  ߿߰' '("* %% " % 00#B(!00  #  ߦ@ % ߿0 ߿0 $ߤߨs#%(d!r߲$gggg gb߰(`%߳ 'P'< ($cJB* %@% +#!H0 00#8@0B(!  #  ߦ@ % ߦ0ߥ8ߤ@߿H ߦ0ߥ8ߤ@߿H $ߧߩ ߼ Q#%C߰G!FED %߱('p $ $'< ('H %8! !$ !@ %@0%  ߲ ߿ ߿߼($ ߢߣ߰ '@ < '0%$BH "! ߿߼' '%lh #  < $!GЎl!! p$%9H+$ H 1 %l߿%l$&l$Bl@߼߰'@ H 1 %l߿%l$"bl$!l  H 1 %l߿%l$$Al$lݠ'$*< $BF%%% "!h߼$&߰g!qaߵ%߱'`lp$gG+@Hh(!e0#$ !(H%0P#` 0$ c` 0%(` %a%Dabaaaab$cda`% H%IIGHHGIl$jl&& J$T$'`&a~ $$8*0#,$0P!(C  Q@!$c$` %(% ~%E$!A$!Ab$A!A$!A$ a@% %H!I%)I%8!$B $c0d8*( .d##$!$!$8tA#`% $*H0H!%&&$&0%񏄀x!$!!#"$g$Bt"'ߴ ߳(߲0߿8߼߰$߱ߵ'`8 1 %lI߿8$%$#{q$$,bq$"(gX%@!$$b"!(%('p8$< P($BBpHX$%@%%0 q"!&B*`\@*` X( Hߩ(0t&A0'P, %@(% \'@%@߿`ߨ$c`߼@߰H߱8$߲X߳P'1 !' 8H@(%@ % %@ ߨ @ %$'X %(I0ߡ0 n4 H@ %@% ( %@@%H%x'`0%ߤ 2$+8x % ߥ߼@߰H߿`߱8$߲X߳P'X %x`0%$` $*߼@߰H߿`߱8$߲X߳P' `d 8(%Dx@ % $*$ ߤ ߿`  !' 8x@ %@0% $*@x܏xߤ@%$*ߦ 2$*؏x % ߥ߼@߰H߿`߱8$߲X߳P' !(% 8d&_ x % ߥ߼@߰H߿`߱8%߲X߳P'x܏xߤ@%$+ߦ 2$+x % ߥ߼@߰H߿`߱8$߲X߳P' ߤH߿`'< $$B>(%%0"!X %x 0%$ $+H߿0߼$߰ ߱('`$ 8(%,@(% % \'@߿0߼$߰ ߱('`| ( %1#L ߤ@߿04 Hߤ@% ( %@@%H%x'` 0%ߤ 2$+X߿0߼$߰ ߱('`߱(%߼߰ '`$ 8(%x@0%$*@%$ߤ 2$߿0߼$߰ ߱('`'$@$< ($B=8%0%%"!#HX %x@0%$ $+p߼0߿H߰@$߱8߲('H(% 8D,@(%@@% % \' @߿H߼0߰@$߱8߲(' H1)@0%@% /Xߤ l(%@R@0%$# % h %@ %$ߧ0% ּE@0߿Hߩ(%D(߼0߰@$߱8߲('x % ߥ߼0߿H߰@%߱8߲('x@%%xP %$+ߦ 2$+x %  (%߼0߿H߰@$߱8߲(' % h %| ( %@ % ߥ߼0߿H߰@%߱8߲('d ߤ @h$ ߤ߿H ߤ @ߤ 2(%4 Hߤ @% ( %@@%H%x'` 0%ߤ 2$+x % ߥ߼0߿H߰@$߱8߲(''p$H$< P$B:X%`%%#"!C!hX %x0%$ $+| ( %@% 8(%@0%@ %x@%'h 2$+߼`߿h߰P$߱H߲X'8$h@ 8(%Dx@ %$* $ߨ@ߩ8$$b@ @"H H8ߤ@ !0(% 8,@(% %@0%( \'@%@z߿h1ߩ@%)2H*<4! #ߤ0(% 8@H%I H @!1@%n(ߥ0 %' @߿h߼`߰P$߱H߲X' h % Hp  %<5@%@H%GH* D߲%(#ߧ0*@ %( 2(!@ % 8(%Pߤ(! xߦ @eߨ H@*P!H* (# ߡ8 @ % 8(%!B$ C&&b @ % 2(%x % @(%߼`߿h߰P%߱H߲X'߼`߰P$߱H߲X'߲(% 2@ %Dx@ %$* $@@$8| ( %x@ %$*@%$`ߦ( 2$P߼`߿h߰P$߱H߲X'| ( %x@ %$*@%$ߦ( 2$߼`߿h߰P$߱H߲X'@ % 2(%4 Hߤ@% ( %@@%xH%'`@0%$*ߤ 2$ x % ߥ߼`߿h߰P$߱H߲X''$($< 0$B50% %%"!C8x %x@%$, $+߼ ߿8߰0$߱(߲'`, %80% \@߿8߼ ߰0$߱(߲'` %' l$@߿8߼ ߰0$߱(߲'`0%H\ߤ $߰0$ ߲I,߿8%߼ ߱('`  r$s@8%A8@0%$cC?$eH` %'Հ %@+ x %@%x`0%$,@ $,0߼ ߿8߰0$߱(߲'`4 Hߤ@% ( %@@% %H%x'`0% $,h߼ ߿8߰0$߱(߲'`$'p` % 0%@ ߦ ` % 'x@ߦ 0%$%'$< 0($c2%8#!x %x@%$,F $+߿8$߼(߰0'`, %0% \E@߿8$߼(߰0'`` @ %@(% 't %$ '߿8%߼(߰0'`%'$< $c1%#!X %x@0%$ $+H߿$߼߰'@(% 8D,@(% % \0%@߿$߼߰'@$ % @(%@߿ $ @߿D ! ߼$߰'@%߼߰'@'(< $B0%%%"!G &h#G0ch&h#$h,$  x %x@%$, $+߼߿߰$߱߶'@, %0% \߿@3@%$8$  L*$ %|` g @(% %f %@&s&*T`` ߼߲߰߱߳߿ߴ%ߵ߶'@߼߲߰߱߳߿ߴ$ߵ߶'@߼߰߱$߲߶'@ 4'x %@(%0% P'@! 8'߼߰߿߱$߲߶'@ 4'x %@(%' P@ 8'߼߰߿߱$߲߶'@ % T'߼߰߿߱%߲߶'@ % T'߼߰߿߱%߲߶'@%'$< 80$c-%@#!X %x@0%$ $+H߿@$߼0߰8'p(% 8D,@(% % \'@߿@$߼0߰8'pd @ %(+ 't %$ '߿@%߼0߰8'p'$< ($B,$%%% "!c$-b{q@*$& ]!BI !,%3(#@ %$ +00! ,8 @%߳@%@߿%@ %(% $ߴ D@ % (%߲߰߱@M߿߳$߱߼'P߼߰߱$߲ߴ 'PH3(#$$0H!&1ͭ < %0%$ Pߴ @XD@ %  (%@% Dߡ߼߳@% ߿B!C$ hv߰ %߲߱'Px@ %x@%$- $+߼߰߿߱$߲߳'P߳߼%߲߰'P&茄Dx $,$ @ߥ&sq@*$u !茄$-#nq@*Dߤ'Ո @$xd&s 4'%%&'(% %P %$ xe(!@'@%*!' `(%@ %' Tߴ Dx@ %ߦ@%$, $,߼߰߿߱$߲߳'P@I0H!$x( 8'@ % (ߴ @0%x@ %8% $-(߼߰߿߱$߲߳'P'< @$$B(80%%H"!X %x 0%$ $+H߿H߼0$߰@߱8'p$ 8(%,@(% % \'@߿H1h @ %(+ 't %$ '߿H߼0%߰@߱8'p߼0$߰@߱8'p| ( %@%$ 8(%x@0%@%$* %$ 2$߿H߼0$߰@߱8'p('$< (($B'@ %% "!`'Ր$ Z$ h*"A$|#T0 %@(%@0%  @%@6߿0߼$߰(߱ '`x %x@%0$-P& $+߿0߼$߰(߱ '` %ߥ $' $HM0DM$$ L$Dtx $-x % 8% ,@% ߿0 ˏ( % $ (%4 H %@(% % 0%߿0߼%߰(߱ '`"T %'' $E@߿0߱ $߼߰('` %0' l% ߪ@߿0߼$߰(߱ '`$%$$< ' $!$!!' 4%@ (B ' % 4@@߱( 4L %  %߿߼ ߰'@' %x0%%( 0$-@@%90 %(% '߱(@%߿P ߲߰ '@ $4@%@%@ % 3$Dx@8%$ߤ $-ߎ90tx $-߿'x0% 0$-@߿' Y,@ % ߥ@߿' 4@ %߿' '@ X%< 08$!#%(@6!!PH@r@% @ %@  %ߥ '( % $ (%4 H %@8% %@(%''՘ߩ('՘ '՘@$  \ %$ %  (%D % p߱0߰PD p@ %߲H߿@߼8'D %  (%߿@߱0'Ќ< $!!%!!D'9 % =(%H$ Ӹ  %߿߰߼'0'P( h< `($B!pXx$%p%% s"!H@P8$-ߵD&(&+`g&1JVc@ %'ՠ` `%@@ %$ &&1!+$x0%ߤ $.߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x''ը` `%@ @ %!&P+@&1  'հ` `%@@ %!&+  &1$ߤ''ո <@&߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x''` `%@$$!&PH@8߰@߳H߲T!ߵ8߳H߶Pߢ @ߣx0%ߤ $.߼p߱X߿ߴh$߷`߾x'ߪߵ8߶P*P*߲߰@@&1Bߣ$cq0$(ߤ'(!'ո <ߴh@߿߱X߼p$߷`߾x'xxP%x%)/X@%$/ ߤ $.߼p߱X߿ߴh$߷`߾x'$ %@% ߤ($D %@%@ % ߥ(4Dߤ$ @%ߦ0$ ȏ@%@@%D'9ߤ =h (% D % 0% `$ (ߤ $(%4 H %@(%ߤ 0%߼p߱X߿ߴh%߷`߾x'x0%ߤ $-߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x'x0%ߤ $.@߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x'x@%x@0%$.ߤ $.߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x'x0%ߤ $-߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x'x0%ߤ $.h߼p߰@߱X߲߳Hߴhߵ8߿߶P$߷`߾x' % % % %߼p߱X߿ߴh$߷`߾x'ߤߧ ߦ0H% H@k@%߼p߱X߿ߴh$߷`߾x''`p$ < h($BX%%`"!% e*`dX a$  _  8(%,@(%' \ %@d߿ 0! }( 8(%,@(% % \'* @iP0c`|08@$H (%$|%$T &s] %' %@P* &1'@%'`0% % % %@3&R동P*>߱ߵ߲@߳8߶0 %ߥ(ߦP @%߼p߰`߿ ߴh߷X߾H'X %x0%$ $/߼p߿ ߰`$ߴh߷X'߼p߰`$ߴh߷X'߼p߰`߲߱@߳8ߴhߵ߿ ߶0$߷X߾H'߿ ߼p߰`$ߴh߷X'| ( %@%(% 8%x@0%@%$* %$ 2$߼p߿ ߰`$ߴh߷X' ( %@%(% 8%x@0%@%$* %$ 2$߼p߿ ߰`$ߴh߷X'߼p߰`߲߱@߳8ߴhߵ߿ ߶0$߷X߾H'< '$!P!! ߿ %߿߼' '%@N%@ % (%  0%@4߿ % ߥE$ % < %! )߿߰߱BP'@C`'$' % < %\  % % <0# %$' < %` % % <0#߿߰ %߱'@ %$' < %߿ %$ <'߿x $/(D(%  $$< '$@'!$$$~$~(%$~% &߼%߰'0#1 0%@(߿߼ ߼$$/߼߼$$:؏ 0%@߿c`߼$$$x $/ߥƏx $/ ߥ܏(D(%  $$ߥ(D(%  $$ߥ' < $!`!!%'% 4%$ $ %DƏD(`%@ %'`0%b8! `]2e ̀ % H+)`  % $a(%$8%@J@%(J@ 0%%+@% $A % $`(%%+ % #( $` %%+ % # $`(%%+@% C( % ڑ %X+`% %aP%I+`  % H+ %+Ci`  X%+X %iA#` +%!h a` ! $B0!`0%&  %!8% % 1߳( J#*`($PJDP!P %$ $A$B C$B`I$B J$B@A$B C$BT`A%E0(!' 8߼߿߰߱ ߲'PD'9  % B'B('9  % C'<('9  % Cl'6( %%J P+ % $#I H+ % $j*DI  + P%P $iIA$ +!h $da }`%'80$/@%(1C% %$~# BV` %@(%0% <%` %$' <%`&%$#&$` %` %$' <%` %߰ ߱8߲b߳@ߴ߿ߵ(߶߷0'`$' ` %& <%߿'HD@X'9 0%P @%ߡ@% 'ЏAJ$ (08$~$\$/$# ߡ'  % (%0% <% %(%$ <%&@%B#b#@&Bb1 % %$ߥ <% %߰H߲߱0߳(ߴXߵ߿P߶ ߷@߾8'p$(% % <%(08'' %% "%0($ %@(% @0%W"l! #`8%$ߥ((!P %% <0# %$'@ <%ߡ! P@$:8 @ %@%+ l%$: &@%@߿(X`$~P$:'Hg& `XP$/$~'#@W'"A- % (%@0% <% %(%$ <%`*&$$.$.$.@%b#@&b %$' <%!# %$' <%֒߰@߷0߿(߾`߳X߶P߲߱ ߴߵ8' % (%@0%& <% %(%$ <%&l % $:@@%#W '鏙l$/ &$&( @# 3Z%@%߰@߷0߿(߾`߳X߶P߲H"@J$~C  %@l$/ &$&'  % (%$ <% %$%' <$ ߿( %$' <%s %'"8$)$8$' %߷0 <%P@(% %%0# <$߲߱ ߿(ߴߵ8'߰@߷0((!8%$ Q% %$' <%Cs&R&Qx(0 $/$ ׏!0$ߨ$ 8a@ (D(%  $ﯗ'`p<  $!0(!!' 4%B@W$CH@X`P$xGSh 8'߼ ߰P߱xB߲(߳@ߴ`ߵh߿߶H߷p߾X'H@X`ߨPxh@Pߣߡ$/'؏`%#! 0F@ %F(# %ߨ0Џ΀$.&$Z$~$CwJߨ0S  %H@!@ %$ߥ <%&s % %@ %b(! %Ff!$ D$B&$1 % %$q$$ $1 $q$Pꐃ%Q$B1$~g&@ %(% %@ %$ߥ <%%%A$B1C$BqG$B H$B A$B1C$BPqA@%@%D@ %(% %}H@X`ߧPx4hPD$\ߧ$/$:ߣ$B @%'g!F@ %F(# %ߡߣD$!$B #cߤ@(%0%̀@% @Ȍߧ@%$~$.D$~F@&H`ߡ BD!B" %b@ %$ߥ <% %C% 8ߥ8@ %% (!Fߢ8F!D$B&$$$&Q$BI)Cg$P@ %(% % %H@XߨPxh$Px'ߡߵ %!$: ߡߣ$!#Rߥ'%̠ (%Dߤ'9 ' ClDd@%l@ % $:@,@ %@ߡ&$ߥ <%q&+ % %@ %@0%@%(% <%!&@&bb %q&@ %A7& &a t (% % % %@ %@0%@%(% <%!%&<'<$~%< %$ #&$! 4 %l0%'< D$߿ $߼ J$\@H%@@ %$/  %߰'PD$BFh@ %' A'!$#- 4'D'9'ߤ Gt$b!  4 %l0% D 8' ߿ 8' ߿ %߼߰'P 8!ˠ< '$c#!B$$%%@?FElG" %$. %@ %@߿P+ $+߰`߼$. ߼$$8+"߼%߱'@"(% @@(% %l' %EB &R߿߲ ߴ(ȏ$/  %@% % $:@$/  %@%$:  %@%'%%  '%$ % @(%@߿ ߰%߲߱'Pl@0%' D$߿ ߰߱B߲'P h % %@%x 0%' $0߿ 8 > '@߿ ߰%߲߱'P h %x %x8%$0 $0`߿ 'PP$ (< 0$B8$%$-("!% &cfP@*폇x`xp'h 4p#X%l'$\$(8H$#(@!$!!߱'(% %A$~@8%#@%`]x&@!pߡΠB%$$@%CLH'$:@ @%߱ߩ@" J%@@(% %e@ @%@e &s`% %@ @%@e%`%4'( $@+ߨs%@ ߩ  hߤ$ߢ%"$@(% <'߱H (%'ߤ I<8%@ߣ`> hߤ&D'9'ߤ Gt$!!߰ +ߣ`* %'@%ߧ'8x$8&'0$1`0 8%ߴߡ!w!! (%&s %8%`f @%t'@ %'H0% @%$ 8'ߢ߼ ߰0߲߱`߳8ߴpߵx߿P߶X߷(߾h' hߤxx8%$1Hߤ $1(%xߤ@%$1 $0߼ ߿P߰0$߳8߷('PDx $0$ @ߦ&@*$ !$-#@*$Dߤ'  @&@*xxߦߤ@%$0Ȍ $0߼ ߿P߰0$߳8߷('8%A$ H%$}$ { @@%$ \8%@%%" j&&CH 0%,!0 8 j$%)@@%%'PXPH< 8$!@%%0%%!!x!%x%lhp` $\@ % %@&s&`%@ % %@&hp`l`%B$Cߵp$Cߡ@ %%%$\ &@% %% @ @ %(% %@$}${&Dfߤ鏨@ %$ %@Dߵp`9&1$@߱`߳x4%'` % 1߱`@(ߤ@(%0%8% ߴ߼0߰@߲X߿h߶P߷H߾8' %(%0# <%`^߿hxߤ@(%0%8% I<ߴ߼0߰@߲X߿h߶P߷H߾8'' 4ߴp0#(%' <% `H%`@%,߳x(' ߳x'X'% I % %ߥ( %'(% %(%'% <0#x$'ߥ <%ߤ@(%0% I<%@'Xߴ$}߱`' 8ߵpߢ߼0߰@߲X߿h߶P߷H߾8'B$ I$CZߴ@I߼0߰@߲Xߴ߶P%߷H߾8'I$ /*ߵp $:&&#a  '%&( %(%$&s <%q %ߵp!$:#`@ %(% %@_'[ 4 % '`F  @ %(% %@kg@0(%  %@߿hߤ 4(%߿h ߢ$/$\%ߵp0(%  %@%߿h$\0%$/%ߵp@zߤ 4(%u߿h 'Џ$&s %`(% <%*!  %`(%$ <%z$:$ %' <$( $ %' <$$ :$ %' <$(}{$: %@0(%  %@/߿h  h$:%&  %@bߴߤ 4 (%߱`߿hߢB$ \J8$/9 %$'p <%]0B$\R$/Uߵp %$'p <%r0$' %$( <%*) ; %$%' <$5%'9$@'P'߱`% Iߵp@BߤT ߡ!% %$%' <$#0߱`ߵptx0%߳xߴ $1߼0߰@߲X߿h߶P$߷H߾8'ߤ߱`(% 4ߴ߿hߦ % %$'h% <ߵp0 %$%' <$(t0tx0%߳xߴ $1߼0߰@߲X߿h߶P$߷H߾8'P%$< ' %$B@"!x@%'F $2p߿$߼'0$߼'0'(< $B% "! 8'@%'$ 8D@ % '$ ߧ$ ,H(P $8# PPP!@H%$<$\%6e%p*T@(%'ߤ ' @% % %% %(!@% x@m& &@*%  H* ;ߤ* 7$$wrߤ !' 8F@%@ %(%J8%$$*!!0$ 0%e$(%@ %0%'$d`&0 %(% x@%@ߤH%߲߱ߴߡ߿$߾%#\߰ߤ߶ߴߵ߷߾߲߱߳S!߳ЎE R$@%AY߿߼%߲߰' ߣD@ % 'ߩߨ"@ Xx0%$ߤ $2߿$߼߰' hߤߤߵߴ߶߳߷ȏ|߲߾ (߱؏x@ %$ 2H$2߿$߼߰' ߼߲߰߱߳ߴߵ߿߶߷߾' ߷߶ߵ߳߼' ߤ'' E@ % 8'xߨ@8%'߲ $2$ߤ  '߿$%'P%< $$c0%%#!$X %x@0%$( $3߿(߼$߰ ߱'P$(H( % E$ )|| h % % ( %@ % ߥ߿(߼%߰ ߱'P % ( %@@8% %0%ߥ ּ$@䏙 h % % ( %؏x@ %$ 2H$3߿(߼$߰ ߱'P%'(< $c% #!$('(p % F'@߿$߼߰'  % t@(%@% 8'߿߼%߰' X %' @0% $߿$߼߰' ' 8D@(%(< '$B "!%߼'@l$ ج$x@(% ߤ߿P%$< ' %$B`"!x@%'F $2p߿$߼'0$߼'0' (< $B%%%"!*H *C`X$ I/(x % %߼߿(߰ $߲߱'PX %x 0%$( $3H߼߿(߰ $߲߱'P(' 8$H߿( %@(%  ߿(5)Ю ̏x$ 1h$3h@@% %@(%0%$ ּ' 5) H%H @ %x%'p(< PH$c% '#!$Xl$E ج$@@(%@H%`  %ߤ`$!߿X@% ,$#߼H߰P %߱@'@ % E@%߿XX %x@0%$X $3x߿X$߼H߰P'x' $3 %$  '߿X ߿XH%$ < ' %$!@!!$ Xx 0%$ $3߿$߼'@ ' %@߿$߼'@ %,  `߿%߼'@,'$(< ($Bp% %% H"!V0' 8%8@ % 1h*I@%%)IH@&P%v!$'0 %  2H@%'$ 8%@(% % 2H@%&13$߱P߳H߲@ %(% `'@%@,߿0$! #߼ ߰8%ߴߵ߶(߷'X %x0%$0 $3x߼ ߿0ߵ$߶(߷''0 ` %@x  %߿0x % %)߿0 ߿0  %$c  ~'< X($BPH%%  "!T %'|@%'8E $]$ @߿߼H$߰X߲P'X %x@0%$ $3߿߼H$߰X߲P' C%ߡ (!  4'| ( %x,%3 @ !ߨ X %x@0%$ $3߿߼H$߰X߲P''D 8 %p@(% % F'$X$ f$k$pߨ @Mx,P$!5`qAP!C`ߨ ߨ $  KX %'@@0% $߿߼H$߰X߲P'ߥ  %&F  $ @%ߨ $  ^x$4X %@0% $$ 8'߿߼H%߰X߲P'ߨ $  Տx$4H$  x$4Xߨ $  x$4hߨ $  $x$4xߨ $  Hx$4ȏߤ  ߰ $ߩ )(@8%`%)߲`!%߲&R'&@D 8 %ߡ߰߱l߲`'ߤ D@(%ߤ 1 @ % 8'ߤ   ߨ hh0@%ߩIH!@߸0D'&R 8 %ߡ0$!"ߢ"0߱x߲h %ߥ @0%@% @ %vߤ   ߨ pp8@%ߩIH!@߸8D'&R 8 %ߡ8$!"ߢ"8߲߱p %ߥ @0%@% @ %Iߤ   ߨ xx@ߩ@%@%IH!Aߤ@' %̀&R 8ߨߩ@B%)H@߲߱x %ߥ @0%@% @ %ߤ   ߨ (ߩ@%IH!@߸(D'&R 8 %ߡ($!"ߢ"(߱|߲ %ߥ  @0%@% @ %' 8Dp@(% % F'@I߰$$߱ߣ $hG߱x$4؏ ' %߿߼H߰X߲P'ߨ $  N߱x$4ߨ $  ߱x$4$  ߱x$5$@ %߰' ߱$ IVߡ Zߣ$hߡ0cߩ$8c@(&,caH ߤ ߥ@(%ߤ 1$$@ 0 t %x@(%  %߰@ % ߰$E(&ߤ (+}$ߨ $  x߱m$5ߨ $  ߱xf$5ߨ $  ߱x_$5ߨ $  X %x@0%$߱ $5X$ߨ $  ux߱K$5ߨ $  ߱xD$5ߨ $  ux߱=$6ߨ $  x߱6$60ߨ $  X %x@0%$߱ $6@/$$  |x߱#$6h$(%19-' 8Dh@%'' A@ %$G)I ߰@d A0$G珙Џ$)'H'Pߤ'8& 1( @ @%' 8Dh@%'' A@ %$߰(`d A0$H 쏙Џ(ߤ(!$ 1@ @%Џ' 8Dt@ % G @ax % E߰D' 8߰t G @ %@@% @ %@0%ߤ 1@(%D' 8߰d A0@ %@,$H2$ IЏx$ߤ 1$4' 8Dh@ %' A'􏙋 % (%@%%̏$ !&R 1h@0% % ߥߨ؏% @*߲Џ x % @(%e߲߰@ % ߰Џ@(%ߤ 10#Zߤ (%T  @&-$ ,@ % '$A'D 8 %D'9Np@(% %' S߱5@%}@ % '$A'D 8 %D'9Np@(% %' S߱ @%ߤ$ 1菙l' D%Dߤ 1H$ ~ )I 菙p %@(% F'@߰$A$~# p %@(% F'@߰$@ % '$HJߤ؏D߰ ߱Ꮩ@ % '$ I<ߤ؏L߰ ߱ӏ@ %$ '$Aeߤ߰'߱@0%C!' 1@@ % '$Hߤ؏<߰ ߱,@ % '$ I D'9R ߰ T߱@(%ߤ 1$'D 8 %@% % (߱@@%H%x'X@0%ߤ 2$6X$'D 8 %@% % (߱@@%H%x'X@0%ߤ 2$5v$Џx$ߤ 1$4oЏx$ߤ 1$4g'D 8 %@% % (߱@@%H%x'X@0%ߤ 2$6R$h@ %' A'䏙(% '$5䏙h@ %' A'쏙(% 'S' (8%'`0%% '<$''h (% Ռ %@߿0߰8$߱(߲ '`'`F '< % (%$' Ռ'p@߿0߰8$߱(߲ '`'`F '< % (%$' Ռ'x@߿0߰8$߱(߲ '`'`F '< % (%$' Ռ'׀@߿0߰8$߱(߲ '`'`F  '< % (%$' Ռ'׈@߿0߰8$߱(߲ '`'`F$ '< % (%$' Ռ'א@߿0߰8$߱(߲ '`'טF< '< % (%$' Ռ'נ@߿0߰8$߱(߲ '`'`FD '< % (%$' Ռ'ר@߿0߰8$߱(߲ '`'`FL '< % (%$' Ռ'װ@߿0߰8$߱(߲ '`'`FT '< % (%$' Ռ'׸@D߿0߰8$߱(߲ '`'9R TD<@8% % (%$ Ռ'@߿0߿0߰8$߱(߲ '`߰8%߱(߲ '`40$ $`$@$44'''ȏx$B6xx$B6x$B6'''`< `$$B@XP%%H"!x %x@%$6& $2p߿H߼P$߰`߱X'%  %$@߿HH,߼P߰`߱X' %' (%@@ %߿H߼P߰`߱X'  % %@@ %$C$F,$@&%-  !߿H߼P߰` %߱X'x %p $6ߢp߿H % % $F@ %ˏ$߿H߼P%߰`߱X' h %߿Hhx' $6 % 'ߤhhx % $7ߤh' %'X'h'H'8'(' `%%< +%$0H %!wh&h#1wh&h#+ X %x0%$ $70߼߲߰߱߿ ߳$ߴ߾'`"T8% 0%3%@@ @! +$ B$!@(%@B %(L.%`a%̡$ aaa aaaa$c ba$ aaa aaaa$c `bٌa̡knm lknm' +!$ C`* P %X%  %@% % %@% % %@% % % %H %`߷߹P߿X߸ b@%`% %߬`03+%x%߰H`0!Ρ! &%&$!& (%@%CH%P%8%@?߷(M߷$p%$%8%A!$%%$ @` %B@$#Ka a$$$@ $J@$aKܬ`A! @` @ %XP@(߲H8`%0%߳( %@0%`8% % %@J@% `_ %ߧ`@0%%% 8!&1߫H@=@% L&&s&RX!`p%&h `*r ߷ߴ0߳8߲(߱@߹P]߿X@P%H%@%8% %(%`-%- hߤ| (ߤ@% !(% 8@0% %x@%' 2$8$߫ߵ߷`#߶ߤ0 %ߤ8 %ߤH %ߤ( %ߤ` %߸| ( %ߵ؏x@ %$߷߶ 2H$7X߫`$߬@'߼߲߰߱߿ ߳%ߴ߾'@(80pp!kxP@(80߫P߬@`Qߴ8phߥh cߥh ln߷H߶h%%߾0`+׸!߫(!˰!1+!1@$ߤ 8%(!0% ּ@k&RKX*`&$!߫`$!߱h,`*%+!X H@%$߾߭h߮߫p߬P%kp&%%lh % ߥx@@%$ KD$ %߬%S߫ hߤL߸ߤ@ %r߸ߨ(ߧh߾0% %8! %@txߥp $7xߥߧ`ߦh %ߨH%8! 0!@txߥp $7߷H %X  ߿X@%߸  %K$ Lxߦ'x $80$ߤ  'x߸%`%N.M-L,K + N.M-L,K+%%% %@0% @` @`z'`H$@< ($B '%(%% "!`Xd 8'@@@%P H°!+'I$ $#@$ 8$0$- $%'Hߤ 0%ߤߥ 2H$ xtpP%%08$ % $&+ $0#xߡH*ߣ'I0 x&*ߤ 2H(% $hp $ߤpx$]ߣ0`R 4<ߤ'H 4?ؒ$$.H)1H!)1)& ߱菙$ '|ph  %|aߤp$$ߨ$ #jߪhߨ$ $+F f&&&F&1f$+fH @!1&$*$ '|ph  %|tߤpߪh@8xߤ ߥ߷@ߵ8߶`ߩ߰X'߱P!߿H߼(߲߳ %ߴ߾'ffߩt<@@%(I @ 4!"H*%) )@ @&t@(%ph  %#ߤp X%`ߪhh%ki%k a%k c%k` h%ki%kU h`%$.&c@h!c0c`$*$ '|ph  %|pߤpߪhX %x`0%$ $8P߼(߲߿H߳ $ߴ߾'"p@&@(%ph  %)ߤp X% <ߪha%k c%k`h%k i%k a%k c%kT`a`%$lߡ$ hߣ&$#*x $ d& t$c8p,y|C!Hp ߤ䏦x ߤU߿Htx0%ߤ $:ߵ8߷@ߨ߱P'߰X ߶`ߣȌa$!߿H ݬa߼(߲߳ $ߴ߾'ߤߵ8߷@߱P߰X ߶`ߣ%&xߤߥ h !'x 8ߥh@%ߤpߨ&%tx+'Hߤ @0%kנߤ'H D&ch)ߥߦh(ߤ(!'  %@ߥhp%(ׯx@ߩ tx0%ߤ $:ߵ8z&x'h $:t$ߤ 'ߵ8%p$K@`%ߣc*`%$$.&&&1$ h)&0&1Sߥߦh(ߤ(!' @fߥh %$xߥߦh(ߤ(!' @Vߥhp(H $ @x$$A@}xtxh0%ߤ $:XEߵ8ߨ @*hpߥߦ(ߤ(!'t ߤp@3ߪhߨ&%ߡߩ!H*h pߥߦ(ߤ(!'p ߤp@ߪhߨ&% ߤ ߿Htx0%ߤ $; ߵ8 X% X%%'$< $c%#! %x@%'pF $;h߿$߼߰'@ Ǥ %@߿$߼߰'@t %@(% $߿%߼߰'@'p(0<  ($B%%%%"!%%&P &P$-ߤP*񏇀xޏ 4'ߥ$' <FH@@%0 %`@%d &s !H!)1)   %b߳` 4'؏ߥX$' <ؐ%@@ %`%d &sH @!1  %b߳``ߥ@ % <߱H@%@߿P' 8%' 8%߿P`؏th*8 gHߵh%߰&%G@0%'ؠ '@ %'8% |%@55O&'' (%` % %&1VP##ߡ!A0!A! @@ %'ؘ8% |%ߢ@C@@ %8%8% |ߩ@ߨ8ԡ(@ %'ؐ8% |%@͏@ %x@%'p $<߼(߰߱H߲0߳`ߴ ߵ߿P߶X$߷߾'@ %'ؘ8% |%t@ %0% 'ب߼(߰߱H߲0߳`ߴ ߵ߿P߶X%߷߾'HߨXd@ %`(%0% 8%@%d߿Pxx@ %H%x%;$; $;h߼(߲߰0ߴ ߿Pߵ$߷߾'߼(߲߰0߳`ߴ ߵ߶X$߷߾'Pߤ'x @D$&ߨ$-%ߤ!ُDx $;@ꏙD$ߤ'؀ @ߨ&%߼(߲߰0߳`ߴ ߵ߶X$߷߾'Ꮡxx@ %ߦ@%$; $;߼(߲߰0ߴ ߿Pߵ$߷߾'@ %0%߶X'؈ ߳`߼(߲߰0ߴ ߿Pߵ%߷߾''0@`$-p(< X$Bx%H%%P%%h%%0 )"!ߢBCߴh%ߣ&u@#%ߡߵ$ߨ#ߴJ 4'ߥ$' <F8@@%@% %xxߦߤ0@%$<0 $;h߼h߰H߱@߲x߳X߿߶p$߷P߾`'В &H @!1 ߴ 4'؏ߥ$' <ؐ@@%%@ % &!H!)1)  ߴ' 4ߵߤ0 <ߥ8@ߣ`#$' 8 %߼h%߰H߱@߲x߳X߿߶p߷P߾`'ߨ%$ %%%%% %%%%Uߣg%ߨߡ$!ߩ%)@ߵ菙ߤ0ߥ0% ߧ@ @  ߤ(%'ߢ'  ߥߧ'%0#8#( <(!ߪȍJT$&$\ߤߢ@%$׀ .A %w  %%% %%%%%%& *0&`1*:/3 %@%Uŏߤ'ߥ '$&@$\`ߧߥe#$!'E(#(! <$&$\&@&( &%#$%%/I $@(% <'$&ߤ$\aߢߧ(ߥȏ$' <(!ߤߢV&$@(%' <&&$&$\$ߢߡȌ#!8ߨ ߵ@ߴߩ ߵ ߴߨߥߧ$'8# <(!ߤ08ߥȏ8% | @ ԏx'ߦߤ0@%$ $< $ߥ 't$ߤ0 '%ߨޏ' 8 %' 8 %'@ %ߴ'%)'ذ @!$$-&hP&D ߥ@D$ ߵ$ߴP%$@(%' <3D' $@ ߨ&H#%(0lߤ0xx@%$&R&P&1fSC!B0B8%@@0% 8%%p!1$$'$!&p!F%̒&8@0( xhߢ8ߣ($BC@ߤ0߳߾h߱p߷xtx0%߲ߴ $>$߿``ꏐ߮ 'pߤ ߼߰߳%ߵ߶'ߤ@ %@%@%ߢ('x'x@0%ߢ(x0Ix#@P%x x!!)% p! f0!% HP%%@ `%)! h0%́44́@@́LĹ́((́́́XX%`!ax%a8!`%*h!!a*0!!*(!!* !!*!!*@!8!! ,8mXaDfed(c4x@oLP\'!%l`́"!J!n*H!!*@!!*8!!*0!a!*(!!* !!bj!ih g,f8XeD(4@LdPb\!%`"!J!*h! h%%% %@%a!!5! !5!,!!5!8!s5!Drni(h4c@bL!5!!P!5!\!at!u!tS!U!s p!Ր!r,.H!5p!n8 @!H!iDh!u@!hPC!U!b\ߩ( *H ).D 0$ 0#IP#0*!'xX1HaX#0! XnX!!$  @/H%) 0%! ! ! !,!8!D!P%!`!\%c %@ @,@8@D@P@\! $"` #  , 8 D P \A$A`@C@@H% \ P D 8 , ߤHȌԯ ௯쯮$,4<(D4L@TL\xXdߥ d l߮($f$cXN*$s8Ap $u$d߰H'xk(߲(%' ߤ0'8% |%@J߮H&Np!U&1  &$2ߤ0߮HȎ/ %' (ߤ0'8% |%@*߮H&'' ߤ0'8% |%@߮H%Ԑ' 0ߤ0'8% |%@ ߮H&8% |%@߮Hxߤ0@%'p $<߳߿`߾h߱p߷x߲$Nߴ' ߥXߤ0ߵ߳߾h߱pt߷x$߲' ߴ<߿`xx %ߦH@%$=P $;h߼߰߿`߳$ߵ߶' %+߿`tx0%ߤ0 $=x߿`߾h߱p߳߷x߲$`ߴ` % %߿` ! $p@%`%% %@%`8%X%`% ُx&% ߢ($$!=/$B(!`$&RF H%F&1&R$&xP'h $>`ߤ0߳߾h߱pt߷x$߲'h ߴ$߿`$JW$&R߮@'9$.p!u@P􏙁ߤH(% $ l$ *$ h$ LߨP$]$ߩ$_,$tx0%ߤ0 $>߳߿`߾h߱p߷x߲$ߴP􏙁ߤH(% $ lߨP$ *$ h$ L$I $]$ߩ& &1F.&R􏙏tx0%ߤ0 $>@߳߿`߾h߱p߷x߲$hߴ@% ( 4 @ L X!F!%`"!U!p!5!h!p!`!h! lX!`! +H!uX! I0!5H!߭ \PD8, NH%'$< $B%"!X %x 0%$ $>߿$߼߾'@(% 8$@(% H %߿߼߾'@$'$< $$B %%n"!$(0$ 8'@%'$ 8%8 % (%ߤ@%%[@PHm%X߲@%&RX %x 0%$ $>߿(߼ $߱ߴ'$(# 1h%@0% %(% %@ %f@*&R&1(%@&s'P!'$T%f@*߰0߲X`%` ߳Hߥ%(#߳H 1h(#@0% %(%% ߷@x %߷@(% ߶P߿(ߵ8%ߴ߱߼ '(0'P@߰0߰ %$ 1h%&1@0% %(% %&)H*  %߰0߰0'0< ($B%% "!T %'|@%'% $^@߿߼$߰߱'ЏX %x 0%$ $>߿߼$߰߱'Џ| ( %x,%)? ߿ !ߨ 1ߤ@߿߼%߰߱'ߩ$!@@X %x 0%$ $?@߿߼$߰߱'$88ߩ$!@X %x 0%$ $?@߿߼$߰߱'ߨ$  8@X %x 0%$ $?P߿߼$߰߱'ߨ$  @X %' 0% $߿߼$߰߱'ߡ$#@X %x 0%$ $?h߿߼$߰߱'ߨ$  @X %x 0%$ $?x߿߼$߰߱'ߨ$  @X %' 0% $߿߼$߰߱'ߡ$#@X %' 0% $߿߼$߰߱'$H$ Pߡ$#ߨ$  8@X %x 0%$ $?߿߼$߰߱'$HPHߩ$!@X %x 0%$ $?߿߼$߰߱'$  @X %x 0%$ $?߿߼$߰߱'Џ' ''$ 8%ߨH@(%JߤP`!LH+ F@P%5pX!$'$ 8X@%' 8$ `ߡ`(!(#$#+ h%߰`ߩ`&1 @# Tߤ(% &@ߨh %ߡ8 Xߤ@ ߥX߿P%%JL@+8%H+ A#$H+$$P!@+ǏpX!P%+ %J8%+`H $+$$ 8'@%' 8$ T@(% %P* j0 x# $ (N$h ߤ@(L ( ߿' 8$  %' % @߿߼$߰߱'Џ' 8$܏' %% $@߿߼$߰߱'Џ$ 8'ߤ@@(% 1ߤ@ 8' !D@+`߿@%H#IH!Ap$ 8'ߤ@@(% 1ߤ@ 8' !D+ H߿@%#C!;x' 8$( %' % @߿߼$߰߱'Џ' 8$0 %' % @]߿߼$߰߱'ߨp& )!H!)1)   ߿ߣx& (H @!1 ߿' 8$ߤ@ ߿$ 8'@%' 8$ p@ % x(%@(% ߤ@߿@$ 8'@% ҏ* Ϗߥ $ߤ@ 1(!߿@*$"(%P%$ _ߡ08%%x#0!x!X%`%J$ $ ,!!0!@ (%mX%$ (#$&( ߤ@߿)p H*(% "X%$ _ߡ(P%x#x!8!x!0%$%J %k,!!0!@ @(%0%$n(!%&( ߤ@k߿܏ %'% $@߿߼$߰߱'Џ$)I@* P 8%@*N0#ߥ$ߤ@ 1E(!F߿'p$$ `(<$B$%% L"!(0H@PX%$-߶ 8%$&B$v"X@ %x@0%% $@@Q%@!3&r *I&1&s>+% @ %,A$b& =@%Bb $c$v@ %x@0%% $@@ҏ@ %x@0%% $?@B(XP0H@8&rߨ %1ߤ߲(߷8߱@߰H߾Pxx@%߶X$@ ߳` $;h߿0߼$ߴߵ'xxH%xߤ%?$? $;߼߰H߱@߲(߳`ߴߵ߿0߶X$߷8߾P'߷8߾P' 4߶XPTP!JI$[$$$\ Q@%F  \@@ % 0'$'' <%PP!@%F9ߡ%RSߡ%Jb Ol@(%ߤ '@_$@(%' <%@% T%A Eߤ$쏙䏥 $$HYߥ!&$'% < hߤǏ߲(߱@ ߳`ߤ' T߰H߿0߼%ߴߵ'P0#(%' <%P0#߲((%'߱@% <߳`㏙P0#(%' <%P0#(%' <%ߤ%J%Jů 8'߼߰H߱@߲(߿0߳`$ߴߵ' 8'ߢ߼߰H߱@߲(߿0߳`ߴߵ''<$!zp!!$%'%$ 8%'|$-%)@%^PCd)HXx %$ߦ $@X߼߱߿ߵ$߷߾' ' 8%$%J%H@]%% 8%@%A$d&s#.% 6$ $(9p)<e& * A%CpN  %' 0% D@'߼߲߰߱߳ߴߵ߿߶߷߾' 'u !% 8@%%яD@ % '@$Dߤ @(%,Tߤ x@(%@% %ߥ @0%A@%ߴ߳$߶ߴ߳%߶߼%߲߰߱߿ߵ߷߾' h %ߴ|߲߳ % (߶؏x@ %$ 2H$@$&ߴ(@*u !  %' 0% D@ ߼߲߰߱߳ߵ߿߶߷߾' '' 8%$  G$菥߳ % ߶$A@%x@0%' $@؏ %$'  ߲߼Tߧ %'ߦ@% ؎@ $߼߱߿ߵ$߷߾' @-$A-C-$H?%)&'% 8@$-A#ُTH$ - $&s&1 %' t@߼߱ߵ߿߶߷߾' %$$$| ( %@ %@%'x@0%߳$߶ 2$@I$&%J' $<$$Bt%%"!  %' %@d߿߼߰߱'X %x 0%$ $@߿߼$߰߱'$'3 ;@%%@  %`(% %@3&12 % ;'ߴ߲D߳<4cB@@1F!(##  @#H @!D F!!F !x'D&  $A h %| ( %@ %$ 2H'߿߼%߰߱'߼߰߱߿߲߳ߴ'ׄ`'`X<p($Brhx%%` ?"!$8 $a@H%CP$ dJ$i@%#߲8$'ߦP% ߲8$@ߪ`ߩP-) 'hA0x %x@%$A& $;h߿X߼x$߰p߱h'x %x@%$A& $=߿X߼x$߰p߱h'x %x@%$AH& $A(߿X߼x$߰p߱h'p %HH0%@%% $P@7@%'+@0 @$wA$BD0@`$ u$BI@ %ߥH 0% % 4' % 4&E  %' 0%p %0%H%@@%'(H $P@ @%D0$ r 'ߢ@ΎD߼x߿X߰p%߱h߲8'x@0%$ $A`@lߩP-) hߪ`$Ax %x@%$Ap& $;h߼x߿X߰p$߱h߲8'$' ߦP@ߩP-) %$%@H$iߪ`$Ax %x@%$A& $;h߼x߿X߰p$߱h߲8'& %X%$ r`(%( %4B$ r $D$w$$udR4B@4B @L0 $pH %0% @%&RP% @8%@@@% ߣ p %0%% @8%@@@%ߣ #ߪ0 *򏙁($(%ߦ  % @ߨ(hߦ0 %ߨ(@8%% ܘ4@ߤ(V %Tߤ(& %#8% %%@$$ r$u"$ wB"6R@x %x@%$B $A߼x߿X߰p$߱h߲8'6R6R @동 $ $D @ߩߨHI@%@P%$D  %ߦ` %H@@%4@% X$P@ ߤ߼x߿X߰p$߱h߲8'ߤ( %߼x'<$!l%%%@!! @ %߿q$`2) 2*@ ߱%@߱菙 @ %  %߿߼߰@%߲'@߫''h %X ' 4؏&  <'' ߥ' ߥ2! Q$'0 <' HIߦ%)ITߪЍAح@| (ߤ@%B$Bbߤ @ߤ  $Dߥ@ % ߤ ht܏$ߤ- 0 ߡߪȌ$ * %) -$$$䌃`)' 8߿2)  $'8 <'2*@@$'@ <'ߥߦt$'$ | я @%Տ'p<`$$!iXh%%.!!HP` % %@@% %' (%@@%߼h߿H߰`߱X߲P'$F$H$$A&@%,!  ߼h߿H߰` %߱X߲P'x %x@%H$B(& $;h߿H߼h$߰`߱X' h %߼hx' $B8 % '$' $(%$68 $xI%68@8%ߤ  0% (<P dx$x%Tx$  <$B@߿tx $B߿' <'$!g0!! $ @% $@$Ϯ$`߿߼%߰'0H'9 ltߤ$߿<'$!f!!%  ` %߿߼߳'0<$BfP"! ' '%  !@ %0%  ߾!߾'߿ߡ߰ '@'P < %e,!J) @< 8, '($$@!(! H'96 @$x$B؏t @$( 4( 4  ($8 0!(*H'9 l!!8 "!*'H 4$@ `@$'H t  (@$(   (0x$B0!0,Iߧ0 %) %@ @!$$x $k%k$$J@&$ $$ $  $ $$9 9 |B$b$|? d"@$ x$D <0# t @$ x$Dxt @$  $ x$Dt %JJ PKP!J$ %) $( @ @!$$a''99%'99'?%%!$ % $( pp!%%k8 $B $!"!!$$'$?$9 &$c` $$ $  $ $$9 9 |B$b$|?$c ((!$ $ $ (@@%8 H*H!($$%(, (%`#0 0KP*@,0!$$ $4$9@ $'4 8(@%@ߣ@88@4, !,0%0 00*|)  t|<||<<<<` ,@{,$ (@@<,%D8%0%($D($D %k %J PKP!J$$) t*$ `+)$ p $׃`F#2$p$' ($'$?$9 $   5$c$c$$B@&$ $$ $  $ $$9 9 |B$b$|?Dd!>$$$$&$ $) $ $  $ $$9 9 |B$b$|?(d! % %k XlX!k %J %) H*H!)$$ 䏧 菥䏆t$ h+0]䏏p $$ׅ`F%"2$ 0P$(% 8(쏤쏙 T(@ %$'0 $(0+0 %$' (צׇ`F'32$ 0@$ $H'9< 4$!$!$A$$ c$cB@  菅t0+]菈p H׉`F)D2$ HP(% 8(쏤쏙 T(@ %' $( X+ %' (ת׋`F+U2$ `$ H'9< 4$!$!$A$$ c$cB@  8 $(0$ppߩp0@`$ xx߭x$)C %  (@%8 C!A?'?$9'9$$&$c` $$ $  $ $$9 9 |B$b$|? $  $c $&     9 9 |Bb|?$c ׍`׌` %k %J PKP!J %) %@ @!$$ $ ($t$$p $'4 8( T(@ %$'0 $ %$' $ $(t$(p? '4 8( T(@ %' $ %' ! ($tC$p (ts(p o$J@ $4$k $'4 8(@h%߯ 94 '4 8(@%ߡD , ($-C$.ߤ($/ߦ($ 0ߨ( $ 1ߪ(K$ 2߬( ,- ,x+ ,+ ,*  ,+ ,(!8! $pC(pr$p$N(t kDxF{Ր $DFձ ($-$.߹(?$/ߡ(" $0ߣ(d%$1ߥ(*$2ߧ(/6׳׵F52$ H%YH -׷׹F92$ X %׻׽F=<$ `%` נ׿F <$p%p סעF" >$%)  פףF$>$%- J$0 ($-C$.ߦ($ /ߨ( $ 0ߪ(K$ 1߬(!$2߮($)0&/ "0&+ 0C* 0 * 00*8 0 @*9 $J)J@C %k  (@x%8 !%$%$$&$9 $!$ $  $ $$9 9 |B$b$|? $  $c $&     9 9 |Bb|?$c P0 % $88! $ $((!$$ t$)0/ %$'0 $(@$ $H'9< 4$!$!$A$$ c$cB@   t4/ %'4 $($ H'9< 4$!$!$A$$ c$cB@  ($9$3ߦ(U$ 4ߨ( W$ *ߪ(Kd$ +߬(f$,߮(hl4$'$?$9 $ B$Bb!  84a 40#40(#0$804I @<<4<lX!<8<p#<<0*0480$0 0 '4A '004b004 %0 040&004 @$0$J)J@C %k 0 (@x%8 !%$%$$&$9 $!$ $  $ $$9 9 |B$b$|? $0  $c $&     9 9 |Bb|?$c@ׅ`HP %k %J PKP!J %) %@ @!$$ T XTt$0STp$`J$'4 8(hh T(@ %$'0 $( %$'` ($ $H'9< 4$!$!$A$$ c$cB@ a$ TXtlSXp GpJ'4 8(xx T(@ %'l $( %'p (`$ H'9< 4$!$!$A$$ c$cB@  XTpXp$ PTt*0D@FB!` XtlDHFJap ($5$6߿($7ߢ(C$8ߤ(:ת`׫pF+RH4׬`׭pF-cH.׮`ׯpF/sH(װpב`F12E$$$$$ )%)I ײ`׳pF3H׷HוF7 $ | ((@H%8 PKP!I(%($' %k  (@p%8 xx!%%x$E t  h| (@ %(x$E$ 2H''x$E@% $$ *k1k`'@H'9?@ (D'ڸH$ADx LDLL$ %(L%kLDL*L h`!%$ o5`$L$;!L$ %L'9LL9Ȁ!'$79$L$;@(! $@'H0 'Px$E@DH  'Px$F@DH 'P$  4$ d(T@@$ @!  @*B % %k XlX!k$$J%J$j$) &$ $$ $  $ $$9 9 |B$b$|?@$d!c d*`< !$ 0* %k %J PKP!J$$)%)$I$$  `*$'($ 8߼ ߿''P@$HX(%%P082#@H' H!A+ !B$U!A P%(%X%(%'@.`%pxhdn `b'  R@h%+@%+% x+B X+ +p ٠  ! @%%X!? #!O %+h!S %+H @%a@ +`x%+ 0%" %`% h M!ύ @%T%X!L? !O %HD+h! %+ @%!` +`x%+ X%nH %`%h M!G @% %X!? C!aO % +h! %+P @% +`x%+ %B. %`%h M!bH%@@%߳ 0!0 #&8!8 (+J+  0! P+0  ! ! B$!ߴh ߱pA!߲* @%߿x! ߰`xp`߾xpt`0%@$F8 %x@H%&J  %x % % $Dx  %$F  ߦHKDF <>D F! F!F!!8, %xH% %  $F߷@  %,H%$\( %x X PlX#$FЎ0 XMP# PߵP߶X`߿x߰`߱p߳8'`%X% %H%`%@@%߳@`% X%%H%@@%`%z߳i %xh`0% %g $G߿xׄ`8@`%`h% b*+X P+kp+ 8 !lX!0+X @ +!j % 8!.8 `!` o%'% h% #|@| ( %xp x@ %xP%'ߨ$G%Gx|$GnX&x%^h@߾0  @!$G 2`߿߰'@| % (߰ߦ|@ %@%܏x%)^h0'߾0!$GP 2`߿'@X 0H(@%%%8P %  &dxph`@@%ߵ%ߴ!a&'&s΀ 8%ubߵ`߳hߴp߶x!&$ @%@ %(%  0%ߴ(3(!ߥ ߤ X%@P%H`8% ߱H߷@ % ߲0` % ߰X߿P߳8'@%<'p%$$0<h#788%x%%~ߥ8 * zߦ0XTP lL%@($a/,<?%)oߣ&<18!&?%kA8߯~<%J~?p!< ߯ ~<%~?#ߢ* * >!*'@%d( ߣ0  %#"!$%)"% % %cbad%k"% % %CBAO%J"%x%x%%"%x%x%ߨ@<߯(7 %ߡ 'pF!%'p'p4h%$ <(@8%$ND@"P# @@#@%$ %$B !"CgKK *F 0!F0*AT,$B%'p(8@0&R<P$Bװ!"!t P%H%H%% a%DFa-pcX& %` 8(% T@ %@I %(% $'D߿`ߤXF@%  hߤ| (ߤ؏x@ %$ 2H$G$߿`P%@H% ׬$ ߼P߰0 %߱8߲@߷H'`  %߿`߹(` Ќ! ׄF "!$$A<42F #$  C #<$4!׍(D`Fc!(߱ HF-cߧ!߼^߿('^߾$%ߵ 'P( !$<[4$̮$(4@ ;%"@ %߿('0@HPX`ph&R<($B!"!tH% X%P%x%%0 %p! %(% 'ߤߩߧ@%@)߿ X%`P%@6ׁ`$e߼߰` %߱h߲pߴx'Џ % 8(% T@ %@؏ %(% $'ߤߩߧ@%@߿ hߤ | (ߤ ؏x@ %$$BX 2H$xߩߧ$߿tפF! E.׃F# F FߡP X׀8F$>E #ׁF! @F MFaߣX`7`H% ߦHTߧ(&R$ (ߡ0߿(!H߿%H  %߿xߤ h&1BX| (ߤ @ %$&% 2H8ߤ @%&&ߧ8 '$P$߿׭ׂF iF-߿0$'%  %X %x@0%$ $V8߿ $߰'P(% 8D<@(%@@%  %@& %( (%߱1 ! 1 !  $ 1h&$@0% % ߥ1xߥ % ߱(߿ %߰'P| ( %@ %x@%'ߦ 2$VH߿ $߰'P$'% %X %x@0%$ $V8߿$߰'@(% 8D<@(%@@%  %@x| ( %@ %x@%'ߦ 2$VH߿$߰'@ % E ߿%߰'@$'H% %X %8% 0% $߿$߰'0| ( %@ % ߿%߰'0'p8@ %H%0 T%P L %$$!)%#Xߤ0(% 8@(%@% %0%'' '' $@f߿H߰@$߱8߲P'x %ߦ0$߲P $V`߿H$߰@߱8'% % (%7(' 4$\@J@%`@5 H3 @0%@% % `(% %ߥ(  0%' 4`%@@%$  &3䏙p x` %@3߳`ߡ !x@xߥ( % ߲P߿H%߰@߱8'` % 1h$@%`D (% +ߡ ߤ '߲P 4$\@@% ߨ  (% $\@ 4'@@%ߨ $  &)X߱Xp x %@珤!Xx % 1h$@0% % ߥ(ݏ$'H% %X %' 0% $߿$߾'0(% 8$p x@ %@ | ( %@ % $߿%߾'0| ( %@ % (%߿'$ %(%X %x0%$ $Vp߿($߰ ߱'` 8(% 8(%< % ߥ@V|0R@| I ߤ &E@R@|I  􏙂D| ( %ߨx@ %P%x'ߦ$V߲0 2$V߿($߰ ߱'`G;@ %@%0% ּ߲0@| 8(%|@% ( %@ %@%x'0% 2$V߿($߰ ߱'` ( %@ % $߿(%߰ ߱'` ( %@ %x@%'ߦ 2$VH߿($߰ ߱'` H߲0@@8% %0%@@% ּ@%@ ߪI%) I ߤ| ( %@ % (%߿($'% %X %'@0% $߿$߰'@(% 8D@(% %0% 'P%H%' 4$@|C0c` | ( %@ % (%߿%߰'@| ( %@ % $߿'8H %@%0 T%$!P$#(ߤ0(% 8 % (%ߤ(@%' 4$@2 Xx %$ߦ0 $V`߿@$߰H߱8'p 1h$@0% % ߥ ' 4 %@H 1$$Dߩ()!ߡ 珙p xߥ@ߤᏙ߱ x %  (%߿@%߰H߱8'p(D$ %'% X8%@0% $߿$'0| (@ ?@(%ߤ 1$߿%'0$'%$% %'@(% E@*߿$߰'@X %x@0%$ $V߿$߰'@T | ( %@ % (% ߿| ( %̎T@ % ߿%߰'@-T@|HB@| ( %ߤ@%(% 8@0% %x@%' 2$V߿$߰'@@鏙E Dx@(%  %߿%߰'@T@ۏ|H !ί$'% %X %8%@0% $߿$߰'@$x %$ x$W@| ( %@ %ߥ 1$߿%߰'@| ( %Џx@ %$ 1$W߿$߰'@$'%$% X %x@0%$ $W@߿$߾'0 (% 8D@(%< X %߿߾'0(%$'p%$ %&@((% 8D@%߿@T@PF (%@ % 0T8$H@%{(`hp%@X!X %x@0%$ $V`߿@$ߴ '` %$ 1h%@0% %(% %& 1@` %@(% x%@` %߱h߰`߳Xߩ ߤ 4'@!E ߶0x߾8 %߷H(% ߲(߿@%ߴ ߵP' %$ 1h%@0% %(% % 4'@E 0$Fߩ 0$)(!@ %@(% x%@ߦ %(w%%߲(ߴ 'pF$' %H% BX8% 0% $߿$'0@%'0| (Џ@ %$ 1߿$'% %X %8%@0% $߿$߰'@$x %$ x$WP@߿$߰'@| ( %@ %ߥ 1$߿%߰'@'0( % % L%$$!Y@%#Xߤ(% 8@% %8 (%@%' 4&\@:x@PH@$x` %ߦ$߰0 $V`߿ $߱߳('@ % 1h$@0%` % (%' 4@%@$RD 4%@ 菙p@ % x (%@⏙RߵPߴH߲@x` %(% ߰0߿ ߱%߳(߶8'%$'H% %X %8% 0% $߿$߰'0@%߰'0| ( %@ %$ 1߿$ %'H% X8% 0% $߿$'0| (@ %$ 1'߿%'0$'% %X %8%@0% $߿$߰'@$x %$ x$W`@߿$߰'@| ( %@ %ߥ 1$߿%߰'@'`PX %`%H T%h L@ %$$@ %)%XߤH(% 8@%@ %@(%0%'' '' $@-߿`߰P$߱h߲X'x@ %ߦH$߱h $V`߿`$߰P߲X'@% % (%DT@ Y' 4$@#P  ꏙ߿`߰P%߱h߲X' . Hx@0%@P%@ %8 <(%ߥ@@ % ߦ8' 4%@ P 0$  0` $I(ۏp xߤ(@A(ߤ( 1h$8ߨ hx gxߥ@@ % ߱h߿`%߰P߲X'($߱h "0%@p !` % 1h$@0%@ % ߥ@& 0! p x` %@菙߱h߳pߣ0`̏ߤ0 4'@ȏxH  % 1h$@0%@ % ߥ@ 4'@H 1$$Pߩ0)(!N揙p x %@쏙ᏙxD(% X+ߨ ߤ '߱h 4$@x D (% $@ 4'@D 0$$Pߩ 0󏙐)! 揙p x %@鏙ᏤPlx % 1h$@0%@ % ߥ@؏P$'$ < $$B%%3"!8(0' 8%@%@ %'' @߿8߰߼߲ ߳0ߴ('X@ %x0%$ $Wp߿8߼$߲߰ '%@6%HX|P8(0'@ % (%@ %`(% 0%8% 2%&* &' !% 8@%@ % (%@ % (% 2H ߿8ߵX߱H߶P߼߲߰ ߳0%ߴ(߷@''<($$B %%0"!X %x 0%$ $W߿0߼$߰(߱ '`''% % @߿0߼߰(߱ '`܏ %'% $@߿0߱ ߼߰('`@H@*ߩh) ! %'ߥ '@ ߿0߼߰(߱ '`߼%߰(߱ '`x((! % ߿0߼%߰(߱ '`'H<@($B80%%( "!' %< 4@ %@߿H߼0߰8߱@'X %x0%$ $W߿H߼0$߰8߱@')(%%ߩ(ߣ($! (c`8߼0%߰8߱@'< 5) 󏙌Pߥ %  ߥP@ %@߿HWx߼0%߰8߱@'X h %| ( %ߡߤX! ߣߨ@8% 3߿Hc`-% )@$IP %ߨ(ߥ& 8% %ߥP@ %߿Hߤ  $ߥߦߦ @ % ߧߨ ߤX߿H(H! %$ \@ %߹ %9 9 ߥߧߤX߿H % ߥ߿H'(<$B` "!%߼'@| ( %ߦߥ@ %$ $߿%'$<$c% #!X %'@0% $߿$߼߰'@ %' tE@߿߼߰'@| ( %@ % ߿%߼߰'@'<($$B0 %%0"!X %x 0%$ $W߿0߼$߰(߱ '`''% % @߿0߼߰(߱ '`܏' %% $@߿0߼߰(߱ '`(8  %$' ✎% @߿0߼߰(߱ '` DH* $ E* 'ߣhc h %'ߥ '@߿0߼߰(߱ '` | %E# (&1@ % (%0 0!߿0߼%߰(߱ '`߼%߰(߱ '`'%<($c0( %% %#!8P0)@% %(% t'@$߿0`H% ߳@$!߳@ K߼ ߰8߲߱('p  %@%$X %x@0%$0 $W߿0߼ $߲߱('p܏' %E $@߿0܏ %'E $@߿0( 0 @*4* ߣ$Dߣ(c@*8#$`8  %ߨ(%&I %߿0H  %߿0ߢH %(%@% H%߿0@`H%x %(% ߳@߼ ߿0߰8%߲߱('p| ( %@%(% 8D@0%x %8% 2$W$߿0'$X$<@$BH%P%%$"!$# X@ %x0%$ $X(߼P߿ ߰@$߱H߲X''('(!8@ % ߱H@߿ ߰@߼P߲X'xT@ %'|@% $X $c8@߿ ߼P߰@$߱H߲X'ߤ8' 8%0%%$;( (&-T`/&1!* -% !' 8$$  &p동@ %@(% ߦ0A@%߼P߰@߿ ߱H$߲X߳'@ % xߥ0@%@ % ߥ0,S`ӏ %(| (@ %ߥ(@ % ߳߼P߿ ߰@%߱H߲X''p`<h$! 0H!!| %PX%% (%**$ ` %䯲௠&8$ܯ% (0&'|'&&T &scH$@ %('߾8(!' @l䏨$  ߼h߿X߰P߲`߷H'!&1!+ C@ %'@%8%`0%% %@,$菈x,%XP( (!$ ߩ0H!1$&1>߯$ܯ$ٯߨ@!@ %%$ ߧ@&1̎>ʯȯ߼h߰P߱(߲`߳ߴ ߵ0߿X߶$߷H߾8'ߵ0߱(ߴ ߳߶X@ %x0%$ $X@߼h߿X߰P$߲`߷H'A  @%@%% %&0%"H!)$@*$$B$LP'9'PP! % p@ \@% % ߾8k'$ 4@ % 8'쏙@(%ߤ@$ <߾8O' 8$W߼h߿X߰P%߲`߷H'؏x$ߤ 2H$Xp߼h߰P߱(߲`߳ߴ ߵ0߿X߶$߷H߾8'؏x$ߤ 2H$X߼h߰P߱(߲`߳ߴ ߵ0߿X߶$߷H߾8'߼h߰P߱(߲`߳ߴ ߵ0߿X߶$߷H߾8' h@ %| (@ %@%@ %(% '0x$'%'%&x B$!@  $  $! "  %` `8L&@ $*G8g v!b%'%@ %@(%0%&R&1 %*H $@(%ߵx߳%'&x߶@(%0%$ %&12@(%߰߿߲߱ߴ'ЏLߵx&@'%%%:%L %߲߰߱'P'9p($ @0%@/ %%  L %1 L'9p$ @0%@% ߿(ߢ߲߰߱ߴ 'P ߿(߲߰߱'P %Ҏ1'@%H%$ %߰'dPh`' t (%$@@߿߰'@@(%$$$`hp'0  % 8x@(%& ߤ` 8'0@(% ߤ ߥxߤ `x $Y߿߰'  '$ߥP)( D(0 $@#߿߰'| (@(%' @I߿ h| (؏x@ %$ 2H$Y ߿ߧp߰'@GߨP'  '| (X(% 8x@@%P%'菅x'$XߤX 2$X߿$߰'` % 8'0Xߤ` 8'0L'9p@(% \ߤX߿߰'# '@  (%@M߿ߢp߰'Pߥ`' t@߿$߰'` % 8'0Xߤ` 8'0D@(% ߤX@ %߿  'ߥ`$)( D(0 ߤhߥ`ߩP@ ߿$߰'ph`'4  (%@߿ߨp߰'ߥ`'H @߿נHס@ߣhF <ߡpF!<`ߥ`'8 @߿84a8*#*ߣh ߨpa@ Q'k`l`!%%$0 %1u +!!0! p(%%@%@%C$B%pF$B%G$B%A$B%0 C$B%pF$B%PCP%@%P% % $@% %$$$$0$$p$$ $$$$P0䐇##%s @B)`l`! d !1&1&R)0߰߱$߲߳'@A*AP#1"P#1 @?d !0`&$  %JJP#.a@>߿ ߰߿ ߱@%߲߳'@ ߰߿ ߱$߲߳'@@d߰߿ ߱@%߲߳'@ .0`, @ %)"P#$߿ .f@ ߰߿ ߱@%߲߳'@ Bk`l`!&R&1);1)$ a ߰߿ ߱@%-F߲f ߳'@߰߿ ߱@%߲߳'@<'$!!! ߿߼' <'$%! ߿߼' <'$!0!!%% %  %@߿߼$߰߱'0 ( %@@% %H%x'( 0% $YP߿߼%߰߱'0<'$!p!!@,`4$ '@߿ߥЌ$" (ߤx@0%8%ߤ $Y߿%߼'0 ' $D@ %' ߿߼'0tx0%ߤ $Yx߿(L(%$  $0Ə<' $!P!!x% 4' ȬȒ %$/%%B*@$ '0x0&1YB %$/$:<&6K' @@40!T#=!߷߱߰߾߳߶B$.C& Ǥ %@^@% 8'߶߳߾߲߰߷߱rߵ߿߼ߴx'' (%/$(%' <%$ %@! ݏ%&1d!cp$`& %F00!0$$BE@%e@%؏%e&150#(%' <%'$'8' <%$ % @ %p  %ߤp ! $ȏ@ % (%ߥp0!Ȍ !(% $8&v' (L(%$  $߿  % $Dȏ@ %(% g<'$!!! %@ ` ߿%߼߰'0 4 %ߥ %$ <` ߿߼߰'0'Ȍ< %)")!''@0%b  %$ @@1JK߿%߼'P߬ȑ$.,h$\cߩ ߤ$\'8@aߤߩ* $ X%`  ߤߣ@;@(%`X%$ .I*X%$ p$D xߥ@ ߤ ߥ؏ߥ$ߤ <$ߩ߫ kߤ 4`(%ڏ ` % '@ԏ $@0!#Ϗ ߤߥ <$ߤxߥߦ I<ߧ@ߤߣߢ b߿ߢ߼'P)$ .*$  hߤߡ ߣߢ،cC!C$ /i (ߤx@@%ߦߤH%'( $Yߢ@ߪJߩBP!I߿$߼'P{$@' <'?!L'9:( ΀%DL'9<(%  0%@ߤ߿ %߼߰('PxX%P%ߨ'P'Hߦ $Y߿ $߼߰('P  % $Dߩ@ %(% "߿ %߼߰('P'H08(< '$>!%%L@%%%&g @@!1@%h$ _ H'H!)1)@ &j x %8%ߦ $]$ $`0# <'؏ hߡ?x %8% $]$ $`(L(%  $K$ i g$b#g$ ߤx@Z  $x ߤx@%ߨߩ $'ߡx'ߤx 00%@% $ߤxL@8%'ȬVP $K@j %'؏xH%%^0 $^$ $ُ h %(x$0%ߤx ҈$^H@(%  %(x$0%ߤx ҈$^X<@8% %x$0% Ռ$^Xtߥx %$  ߤx@%'0< $!P!!%(%%T%q D `(%T@߼ ߰߱߿߲߳0ߴ('` 8 $@% $` % @ $D@ %`(%   ߿߼ ߲߰߱߳0ߴ('`0% %' 0@(%@% $@8%L@(% %QP $K@߿(L(%  $KÏ<'$!Р!!)% 80 ' %0% `% %% 4@% %% 4@% %'0% `%1 '߿߳0߲8߼%߰߱ 'P % ߥ@0@ %0%( 0'@%'@!߿ 08 %0% `% %% 4@% %% 4@% %'0% `%'߿߱ ߳0߲8߼%߰ߴ('P %x@%'ݸߦ $](߿$߼߰'P<'$!!! %  %ߵ߿߱߼'0<'$!`!!% %   % %  %߿߱߰߼'0<'$B"!  ߿߼' <'$!͐!!% 9@ %́p+(!$T́H,@,B ! !@ % 1 ߢ!߿% ߼"! $"0߰'0߼߰'0$돂(L(%  $L  $ $߿<'$!@!!@%(%@ ! 8%E !$g%tx $^h߿߼' $%Y$!߼' * &#"! `$!' %߿ % %߿<'$! !!$@%% 8% )!H%$Tg&ߵ9  %  %߿ߵ  %߿߼߱'0 tx(% $^߿߼ ߱$ߵ'0'`%h%<$B %%ň! %+< % "!k!c5)i$`&0+ +!!)$ $ }$ }$"$ %0&$ x+߼K!< B5)I$@ ߼&+`00!0$߼߲߱߳%߰ߴ'${&b &€ x+@ %R$ "-0$  0`7@R&x+ ) ){)| )!@)\`))]d*A@&R) ) )  ) @) `8)0߿0@r߿0it߼߲߰߱$߳ߴ' #@ @'h( 0 %߭߬$ h$ "$ }ߨ$ ߧ 0!ߤ(&V`&`#p߿0``#&+@ ߿00f!$c74f$`|߿0$  @Sx+ /$VB&`#&+` ߿00!$70$߿0$  `8x+&`$x %0% $_`߿0` t߼߲߰߱$߳ߴ'Z&Rx %0% $_߿0`#/0+P%A+!!< 5))$ x&D+@x%JQ+` F00!0$D+ ؏x8%P0#x'p%_H $_t$ߤ 'p߿0߼߲߰߱$߳ߴ'H%-+ P%BK!B< 5)I$@&D+`%JQ0+ A+!!)$ D+@؏8%xP0#' $^؏t$ߤ '߿0߼߲߰߱$߳ߴ'gH%'< $!(%%%%!!80$\@&1&R"&s`&ߴ8߿0߼߰ ߱ @%߲(߳'` %&R 0'"&1a#0!&s&'PP%%< p5k<$!h$x% %!!8%,!!$%J+$&a @PX8P `@D !X $(0H@% ߲`@%% %V!8&R@ % @0%2!$2 `& %% %L`0%''' '!&*&1@#@)h#)  5r@؏P@ % Ռ@0%2!&R %߼x߰p߱H߲(߳0ߴ ߵ߷hߢX߿@@ߣP@!v߶8^%߾'  %ߢ߼x߰p߱H߲(߳0ߴ ߵ߿@߶8߷h߾'  %t߼x߰p߱H߲(߳0ߴ ߵ߿@߶8$߷h߾'x %0% $_߼x<'$! !!\0% ֈ$߿߼' '$<%$B%("! 'J @%B${C$"G0$0!$  @&1 @*( &߿@&x$6,u$_  !߼8+߱#߲(ߴ $ߵ0 ߰'pB!$B&16u6@$ %8 0'$ 4!ߦ8&@8 @ %ߦ8@(%߿@<'$BP"!d%$8%  0%߿߼'0' <$$!!!%%%U%$ t$ r$f$\ N2IL2H! % Z${*${AP$\ %"+2KQ(#`4(!$n $v&"&$!%&"x$D,u%a  !`&"&&& & ݢ&٢߼#߲߰߱ ߳'P߼߲߰߱ `$ }j$$ {i߳'P6R&1a&pc!H+%(` % % h0!@Ć$$́$B$!C@%$!`X% $ }3P!%PǡI(  %@(%v߿(%C$!'@<P($BXh%%` _"!x'p$p%X%!&1@(%&R $ x%S!4&s߱ߵߴ߲` % %߿p@%@%߳x$ ߳`%߰X!@F&s (%&R`d %Q!$1T6ߵߴ߿p߳x߲߰X'>߶P ߱߼h߷%߾`'  %߿p p %x@%߿p'<$!$%%0!!(P8`%Ӱ!&΀ %"!&1ߴ8߶P  % ߿(<61jߢ XPH@8Rߴ $\`%!>2`  %(% `0%8!$ $&RW7߿(@D@@!@$+%"!!1$ & % %@@%p !b!cq$`*g&s`p !@@!@$*a ~%߾@߷H߶P߲Xߢ ߼ߧ ߰߳ߵ0߱ߴ8'p(߼߰߱߳ߵ0'p@'p(<$!P% %!!@%P%8!@C8!$(c &su `d' 8%ߵP߳@ %$ .H ( 0%߿8<6 ߡ0߲0p`XPh bHߡhߵp$ $\ %!6: @ % %r!W3!&R&s&15A߿8 $8@(%@@!@$ $$"!!0$ ( !b!cp$`$ !@@!@$( v 8'ɏ߷HߵP߾X߶`ߧ0߰@&s@|"@߼(ߴߨ0R2߲߱ H@ @S߳'@߰@ k8 t"߿8$\$-$ ]$ [$ ?'$ *<$! %!!.a&$0@DD$@%+U` %T% O#$O@% %`8%%'$(!$$%߼߰'0$<߼߰%'0*E0**`$D%߼߰'0 *$p % xߥ@߿$߼߰'0`&򏙏p%߼߰'0%߼߰'00*  $߰߼'0$$߼߰'0߿%߼߰'0%߼߰'0'%<$$!!!%&# # G&"A$( % %߿(( % %߿(0 (C|$G`B߰VA$ % ߱߱E$  (  %߿( ߰߼'PЎ0 (  @ %(G1 &$$ ߥߩ ߿(( ߿(׌+G"   |(  %߿(|(%߰( t|߿( $D$!@ %ͮ"( ߿(؏A<'$c  #!߼'0| (ߤF|ߤ (% Eߤ (%@ % 8(%@(%tߤ $ߢ߿B '$B<$B"!$!%  $#& %߿ ߿߼&߰'0   | %ߧ߿|"Ѭ' ߧ߿'!<$B`% `"! "(C`$Ed%|DvA $0% $BF$ "    %߿  % @%@߿ ߲c # $D"@ %@0% %߿ (!2߲$ ߱'! ߿  ߿ &߼ ߰'@  ߿ B$cd$  | |   %߿ |D$ %Q t|߿ D  ߿ 'p@8( xph`XT0<!$B%'X @"!%$&p$&@@ % %!"h!" L$p!c`0!'l0*߰L'9rP % ܔ(%߰&p$&@%h$p% ! @(%@ % %&p0!&p߼߲߰߱@߿0߳8ߴ(ߵ '| (@%G % (@% E % (@%@ % 8(%@(%t % $%'<!$B0%%( 9"!X % x'hd p$@!I(! $l8*LI(!$L'9rP ܔ %hp @!(% %@$ p&R$cpA` %@(% 쏦߼߱p߿(߲ 0!p߰'@| ( %G| % (% E % (%@ % 8(%@(%t % $Xh'% %l(! D   %p ߿ pH!c`   %p߿ lR!&0*!߲1@!*'d$  ߲  %@ %  h   %l߱h߱  %h߿ ߰'@ h  ߱ % (%   %lh'Ќ$<$!P%?!!?6 $߿ 0 ($ 7|߰J$ ' &    %߿ ߰߼߱'0$ %߿ &߿$$   |  %߿|8%߰ t|߿ ߿ߏ' &<$B`(%"! $|`<#߱O$  $$ '   %߿ ߱  %߼߿&$d$߰'0 ߿݌$$$$   |  %߿|" 8%߱ t|߿ ߿ߏ' xph`XPHD0(<$$!%!!$ 'H<&1q$&1' @ %0%x%@% Ռ$cp6&1߼߱߳(ߴP߿ 6P߲߰0''<$B"!%x$% 1h$$cp@%@ %@(%0%8% ּ$4#߷߿$c߰`#߼߱ '@ % ߰߿'@8< $!!!(%%0 %@%% %$cpED&&s  %߳@ߴ8@ % ߵ0 @W$  $ %txx|| &@ %@(% "t߼ 0߲߰߿(ߢ"߱'`@ % et@.߼ ߵ0edt ߳@ߴ8߳@Q!GGFF$BCtQCx%0$t%ߴ8߲߿(߰߱'` @0%x %8% $c߼ ߿(߰%߲߱'`"ߵ0ߴ8߳@'<($!!! %% %@ %(% ߦ@% %@߿ ߼(@%߲߶'P hߤ %x@0%8%ߤ $c߿ ߼($߲߶'P( D!CBP<'$!!! <(%@߿$߼'@ߧ@(%ߤ 0%߿߼'@ $Ȭ$ '<$!!!%%^%AG1!G8*AD(%0`! h% @+$X! p߼K)2!`0%% ߰$B !$I$ % %@%@H%bbbb$c$$!eb@%@H% `8%   (%$! JBQP!߱J߲'P (B ! D@%F@ % ED&G ߿(AS` %߳ (%߰(  %@%߿( ߿( 0%(%`%GJIH$(%<' $!!!X(%'% x %H(!$*@0!  (%$ @ߤ0'&1$` (% 쏦߼ "!߿߰(߱'P ! @ % & $0ߤծ 0'(% <!*%$B "! &$ @ % & d ߿ ߤ߼߰$(!߱'@ ߿ 'Ќ$ <$! % !!߼ $ȯ߾'0 %ߦ߿<'$!!! % h%& $߿(c` t&dd ߳߿` % $߳߿߼ $Ȯߤ߰ '@ae߳'<$ $c%%A##!>  "@(%$$F(C&߿ &#$'߱߼&߰'@  @ %߿  $DȮ"@ %  %߿ `$$Ȯ&ߢ"Ȏ@ % ߱߿ | ( %G| % (% E % (%@ % 8(%@(%t % $ $D!"$!ٮ!<'$Ɩ &!% (!@  %$ <'߾߿߼'0 %$ <'߾߿<'$!!!$ <'߿߼' <'$`'!| %%D&h $c 8%߿$ .0%߼@@ %$$(!!0!@ $߼!߰߿@$0C'@I߰'@$ .`%h%%1@<'H%8$c #!1 @1 `,d%߼8'1@ 1 <@ %(%|0% @% Ռ$cp߿@%߼8'0(  @ %@ߤ0ߥ <|ߦ(ߨ Ռ$cp߿@x߼8'$Bc@ %(%0%@ l$q߿@ߤ0(ߥ ߦ( ҈ߧ'$ B ' @ (C` (Je@߫iߤ0! ߤ0ߥ <|ߦ(ߨ Ռ$cp߿@x߼8'$Bdԏ|ߥ $cp|'$cpߦ $߿@%߼8'$ {<$\$B)"!#$0%(cf!$c74f$`($"BC!$B4cC$@ %%%$$%<'0%$!`#!!*%*H%x$ %߼ %J^ j!`%)c$B#H% %@ P(!@0%$$!@*%)$'߰'0$-$BP8! % '   %߿߼߰'0< %))!(H!< B5)I$8%$-@3$+H!BI$@$#" %% 00!0%$.H!B0B@8%h!c0c`$ $e$E$$%8% %'< $c #!t("*%/ 0!$e#/8 %(% '@%@1߿8ߨ|߼ %߰(߱0'` (ߤx@ %@%x 0%$d@ 2$d0߿8ߩ߼ %߰('`( %80 8'@%߿8 % '(@߿8ߤ߱0߱0߰߼ %߰('`'`0(< $B 8%(%% "!T'@%|'@@ % $c@߿߼(߰ $߲0ߵ8'X@ %x0%$ $d`߼(߿߰ $߲0ߵ8'D$ ߩ߼(߿߰ %߲0ߵ8')) l 8'莤 8(%XPH@ߣ诣(ؐJ`$@PPHߴX&1|$0$@$1&cP'9`'' X'@ x$,9%)g  @ ! ߪߪ)J@X@ %x0%$ $dx߼(߿߰ $߲0ߵ8' 8(%I0%$ ߡ% P'9`'' X'@ߪ x$,I9$cd lC!Cߩ`*H*X@ %x0%$ $f߼(߿߰ $߲0ߵ8'$ߩ*H*$ $ ߩA # @* 6 H@%ߡ%ߴ!&s % 0 %Ԡ!@0% % (%h*`&s|&cߡ$1$0a!ߧߩߥ$@0%$%)(!@ % ּ@[) `P h@ %߶@ߴH|߱`߷P@ % (߳Xߥ@ % $߼( h@ %9߳X߷PߴH߶@|߱` @ % (8@ %@%x'H'8 2$e߼(߿߰ $߲0ߵ8'ߪߩ*H* ,ߩ؏$ #$&$,!a@ P*@$Af(%ߩߤ ! 1hߩ@%ߥ$@8%@0%$%)(!@ % ּ@ ߩ؏IH!߶@ߴH߱`x߷P߳X&hh h@ %| (@ %@ %(% 2H$߼(߿߰ $߲0ߵ8'ߣߡ#* ⏨ߪ$  # Q $&$ ,c#@ * t߸菙߶ Hذ!@ % 2ߤ 8(% $b#E(%@0%ߪߩ*H* ߩ؏$ #* !$&$,!a@ P*@K߸菙߶ Hذ!@ % 2ߤ 8(% $h# (%@0%$$$$$  P&$-J$ *@  ߡ#(* %؏$  P&$-J$ *@  ߡ(* |ߡ ؏$$  P*@t%*`ߥߤ % ! 0(%ߩ6H!؏ h@ %|! @ % ( @ %@%x'H' 2$e߼(߿߰ $߲0ߵ8'&2+aP H* $O&i#O0ci&i#@P%`$ߧߩߥ$@0%$%)(!@ % ּ@A$c$j`*ߩaP PIH!ؒ&Q1JTP!JH* $&##0!#&## $ߧߩߥ$@0%$%)(!@ % ּ@#$!WߩAP! PCIH!y*À 쯰|P@ % (&`@ % 2ߤ 8(%@ % (% 8(%ߤ(A $  h$ @&ߪh%Jh! }'' ' X%@w $,9x(%)e@(! $XߡߪP`AP*H@@$P$  H&$ -)I@ $ aߡ$!F$Af$ b&$ BF%#!C0!$XP`H r@$#ߥߩ$%)PP!! P'$'p(!@ % @ ߤp߼(߿߰ $߲0ߵ8'$  ߏHP*@xH&e$$$$$$&$ ,c#@ !$  P&$-J*@ H* $@%pH*  #$ *0  jXP`$Hk@%߶@ߪߴHI߷P߳X%)߱` ʭI߼(߿߰ $߲0ߵ8'ߪHP!(#%߼(߿߰ %߲0ߵ8'$ $aߤh8&0%,$h0 !' 8$$$d &a&, @%a@ P%H*(aP  @(% 0% @(%ߥ(00# !P&`(#!(ߤh$h !' 8$ $jP&$-Je(&   *d@ 'P$cp$n`*$ B(ap (%pï*p!"`%@8%$ ߤh$h !' 8$ $P&$ -JH& 0  0  * @ $%x$ H(#!$fC$!*Q(%xpx@%߫h$6uX!$$0=,0%&$,B(b0 (% (i!($  H&($-))@ ߡ$ $+  ߪP#HP*@ߡ|((ߪC+aP ߣ$  H&!I p(@ %','0 e$ 0*P&-J*@ ߡh$!^h%P,'90@ % 0!'( 錌@&ߡ$!#* PPH&`4 c&## 0!#&##$ %kH* ($ 1%$0M(C- 8@%($c(e(%폨(I0(J: +0%@)O&i#O0c(i&i#%J`$(P%ߣ*$c ߤx (Ia$A ߥx 0!(Jg@(I0$A 0!0%߰x| h@ %@ % (%xx@ %P%@%x%)h0$hߦp 2$h߼(߿߰ $߲0ߵ8'@%nޯߧߤX%0% !8!!X(%@@0%(%S@0%\%k$$$ (%,$ `%@@%0%O8&8#0O8&8# $ $BGP#i&EH$(EP#P *(+ $((+`$&2+aP H* $$O&i#O0ci&i#CP%`$&24!!P*@$O&i#O0ci&i#`$ߧ!ߧP#`((0%&##0!#&## I $$H(#&aH I(ߩPH+ G&`$(`ߡ(+ $>߼(߿߰ $߲0ߵ8'߳X߷PߴH%)߱` ߼(߰ ߿߲0$ߵ8߶@'߶@߱ߴH*߷P߳X%J*@߱`߼(߿߰ $߲0ߵ8'߶@ߣߴHa߷P߳X$!߱` a߼(߿߰ $߲0ߵ8'% @H*%CI Fp!D%ߩߤX% ! (#߶@ߴH߱`x߷P߳X&h@m`%@8%$ k(%hpx@%<4 Oi&i#0c Oi&i#`%P*$@R%k$1-(@$0m O@%(%((%쏨(I0 E(J:@C$A0!0%O&i#0cOi&i#`(%J(P%$ߣ*$c )ߤh (Ia ߥh(Jg@$A0!0%xG&eߤ !' 8 ߤ߶@ߴH߷P߳X ߱`/߼((0%(0%|߰x߳X߷PߴH % ߱`@߼(ߤ߶@ߴH߷P߳X ߱`I߼(ߤ߶@ߴH߷P߳X ߱`Q߼( $ 'iP%%H i% $H%H $*! !"!!0!  %@(% $ ߣ߿b$'0%'0%B$'$ d0$f0P% @(% '$s@߿ $߰'P$cMߡQ$I$S[$ifߡ,ߣ%߰'P@(%  '$d@߿ $߰'Pפߡߤǁdpe׀@F !EF%FQׂHF `F"*߳@| ( %x@(%  % % h@%D % p߳@߰P߿Hߢ߱8߲0'X %x@0%$ $l ߿H$߱8߲0'|@ ( %@%'D 8%x@0%@%$iH` %$߰P 2$߿H߱8$߲0߳@'0?$  %H$  h@%̏x$$iH 1h$,@(% %$@0% |0%@ %' 8`%@(% %  ߳@(x$0% %$iH$ ҈<@8% %0%ߥ Ռ$ߤ% | @ %} % '0'%$$ %L%#0X %x@0%$ $l8߿0$߰߱ '`0  %@| ( %܏x@ %0% 2$lX߿0$߰߱ '`ߤ' 8P'9 @0% %'L HL@#ߤ' 8 $(4(ߤ߱(' 8 @0%ߤ  (%߱ $ߩH߿0 *$߰߱ '`%߰'`| ( %ߤ@%' % 8x@0%@%$iH %$ 2$p߿0$߰߱ '`ߤ߱(' 8@0%| (ߤx@(%  % hߤ߿0'%$$ %L%#0X %x@0%$ $l߿0$߰߱ '`0  %@| ( %܏x@ %0% 2$l߿0$߰߱ '`ߤ' 8P'9 @0% %'L HL@#ߤ' 8 $(4(ߤ߱(' 8 @0%ߤ | (%߱ $ߩH߿0 *$߰߱ '`%߰'`| ( %ߤ@%' % 8x@0%@%$iH %$ 2$p߿0$߰߱ '`ߤ߱(' 8@0%| (ߤx@(%  % hߤ߿0('p%$(| E%@%N0 %@ (%x8@%0%ߤ 0$l@@%@ % 4'@xHXP`$ߵ`ߴX߶P߳Hx % (% ߲8߿0%߰(߱@'$ 1h%@0% % (% %' 4`%@H($DDX %'@@0%0 $߿0$߰('ߤ0' 8P'9 @0% %'| H|@ | ( %ߤ@%' 8x@0%@%$iH %$ 2$p߿0$߰(''P0((%8l %  %@| ( %܏x@ %0% 2$m(߿P$߰8'X %x@0%$ $m߿P$߰8'ߤ ' 8 D@ % 'H@ߨ0)$ M(ߤ ' 8P'9 @0% %'l Hl@(@ ߤߡ( Eߦ ߥ0$$ߤ $@(%ߨ$ Aߦ| (ߤx@(%  % hߤD pߤ߿P߰8ߢ'| ( %ߤ @%' 8x@0%@%$iH %$ 2$p߿P$߰8'Xx %$ߦ $m߿P$߰8'ߦ ߥ0$$ ߤ ($@(%07ߨ %$8$ h̏x$$iH 1h$,@(%@$@0%ߤ |0%ߥ@%@0%# % 8'@(% %  (x$0%ߤ$iH$ ҈<@8% %0%ߥ Ռ$|ߤ '0ߦČH  %ߦH'$%, %X %'P 0% $߿$߰߱'@  %@| ( %@%' 8$x@0% %H%x'(%m 2$mh߿$߰߱'@$ 8'P'9 @0% %', H,@P| ( %@%' 8$x@0%@%$iH %$ 2$p߿$߰߱'@'9 @ %߿߰߱'@('%$, (%  % t@ %@(%x  %߿%߰'@ߤ' 8P'9 @0% %', H,@ @ % t@ %@(%X %'@@0% $߿$߰'@| ( %ߤ@%' 8x@0%@%$iH %$ 2$p߿$߰'@$'$ % l%(X %'@@0% $߿($߰ '(@ %D 8'P'9 @0% %'l Hl@6 %0 (%@%' 4lPH@@8$$ 1h%@0% % (% `%' 4@%@l!(5$DDߵ8ߴ@߳H߲Px %  (%߿(%߰ ߱0'| ( %ߤ@%' 8x@0%@%$iH %$ 2$p߿($߰ ''0$ (%%X %x 0%$ $m߿0$߰ ߱('`$ 8'P'9 @0% %ߥ H8%@ ' 8$P'9 @0% %ߥ H8%@*' 8$ ,@(%ߤ \0%@B߿0ߡ3$߰ ߱('`| ( %@%' 8$x@0%@%$iH %$ 2$p߿0$߰ ߱('`| ( %@%' 8$x@0%@%$iH %$ 2$p߿0$߰ ߱('`| (ߤx@(%  % hߤ߿0(ߤ $@(%߿0%߰ ߱('`'$% %X` %x0%$ $m߿ $߰߳'P 8'' 8 P'9@0%` % ,ߥ߿ ߰߳'P'0$ (%%X %x 0%$ $m߿0$߰ ߱('`$ 8'P'9 @0% %ߥ H8%@!' 8$P'9 @0% %ߥ H8%@<' 8$ ,@(%ߤ \0%@%@߿0ߡD$߰ ߱('`| ( %@%' 8$x@0%@%$iH %$ 2$p߿0$߰ ߱('`(ߤ $ (%$ߤ  (%@7߿0ߨ($߰ ߱('`| ( %@%' 8$x@0%@%$iH %$ 2$p߿0$߰ ߱('`| (ߤx@(%  % hߤ߿0| (ߤx@(%  % hߤ߿0%߰ ߱('`'% %x%0% 0$j@D@%< (% &߿@@%߱%߰ߴ'` (% %  (@%$$ 1hߴ@0% %@(%0 `%' %% %&@(%`%&0!& ' 8* %ߴx %߳(@(% ߵ0߿߰%߲߱ '`tx $m<'%x%0%  %$iH 0$`@;|Y< (% $D@FЌE  % ،@ %@0%  $D@%@ % ߥ % ( (%@ % (%  0%@tx $n؏ % ( (%@tx $n  %߿ %߰߱'Pxߤ (&iH@ %@%& 0% 2'X߿ $߰߱'P|xߤ (&iH@ %@%& 0% 2'X߿ $߰߱'P%<'H%$!:6!! $߼'@x %0%$iH 0$`@0%@߿$߼'@ߤ ܌E$G߿xߤ0%$iH 0$@tF(ߨ$% 4ߤ߿%߼'@%߼'@$߼'@x $n8ߢ '% h%x %0%$iH 0$@;@%P %'9 (%@0% H8%@@%x %0%$iH 0$`@/@%<ߥ &@7@% @,߰  % ܌E$GD߿%߲߱'P|x % (&iH@ %@%'(@0% 2&߿߰ $߲߱'Ptx $nhPtx $nΎ.lD[@@|&1"Cq $ b&&Y $@ % Q|Q߼߳ߴHߵh߶@߷X߾8 Q߱`ߪ߿߲%P߰P'ߤ( ߦ@X%@:p߰@ % A1#A* >x % ߥpߣx|q!Q`ߤ((%ߦߧ @@%|@xߢx߼߰P߱`߲߳ߴHߵh߿߶@߷X߾8'' 0&"&10!|&߰Q߼߰P߱`߲߳ߴHߵh߿߶@$߷X߾8'Y ߥx@ % QQ hߤ(x`0%' $yȏt$ߤ( '߼߰P߱`߲߳ߴHߵh߶@߷Xߪ0߿߫$߾8'%Jj' <$B0"!4(%%% @%߿ $ ](!@E߷߰( %߱߼߲0'p$A$B߷ (#E(#$@%   %  %0! ߼&  ߰(߿ ߱%߲0߷'p'`0(PH8 @<`$BX"!%ph%% %|߱$x$Q!&3'8!${&1&s7&$r $ % $}7!$\W8&1tx0%ߤ $y߼`߰0߱(߲P߳Hߴ8ߵ ߶p߷Xߨ߿hߩ$߾@'%(ߡx$!xߢx$B@x߼`&߰0߲P߳Hߴ8ߵ ߷X߾@ߣ߿h߶p%q߱('($ $@` % 0'(B %@%$c(h&&s&  $ % q!&3@` % 0'1!&1'<' #8!&* !!%A   %@%@ % 0#߿d#q! ߼(!߱ߵ$$߰ '@ ߿'8<H$!@P!!@%ߣ@0 `0$ "$\ %<61& %!!1$& $ J h S&߼H߰0߱ ߲߳P'I${*(@;$@$]$;$$$[ߡ8s$ J}Pc @h!cq$` ߼H&߰0߱ ߿߲߳Pߴ('ApK&   %' 0%$[$$$;$]0!&$ J&$}j${ p߼H%߰0߱ ߲߿߳Pߴ(ߵ' %' 0%0! J %$}& ߵ&߿ ߼H&߰0߱ ߿߲߳Pߴ('߱ ߿ߣ8߳Pߴ(%`=߼Hߴ(߲߰0'P'9h$`(% &$[$$$;$PSF$]'9g % `(%$[$$$;$PSC$]%߰0߱ ߿ߡ@߲߳P ߼H$ߨ@ߴ('P'9e0$"`(% L&$PS߿(@P ߲߼H߿&߰0߱ ߳P'߼H&߰0߱ ߿߲߳Pߴ('߼H߰0߱ ߲߳P'߼H߰0߱ ߿߲߳Pߴ('߼H߰0߱ ߿߲߳Pߴ(''(8@% % %$$$]H$[$\0.%h(&B'1@3P0%߰8߱@߲H߳ߴ߿(ߵ߶0߷ 'p3& % (%$8% 0%C`!$PG %&&߰8߱@߲H߳ߴ߿(ߵ߶0߷ 'p % 0'!'9g %  (%A $P߰8߱@߲H߳ߴ߿(ߵ߶0߷ 'p߰8߱@߲H߳ߴ߿(ߵ߶0߷ 'p'${$_$@H%Ad!c0c@`+$("00!0@%)G%"I%"' $}" $ !"%) %' P'9e0$) L%$߿' ݑ"'(0$ \ $ #%8%$%<$ 6F &!!0$`(% %d$ &,D` f!cp$$`$BS!l,  hl&stޒl,ۍFh` %(%0% 0'$D$ #T$ \%H$](ƒlcq@&bT@` % 0'$ #$ \!l߰ ߲߱8߿߳0ߴ(ߵ'`߰ ߲߱8߿߳0ߴ(ߵ'`߰ ߲߱8߿߳0%ߴ(ߵ'`߰ ߲߱8߿߳0ߴ(ߵ'`'8%P%h%`%<$${$B+%$:%"!&"a f!c0c@ %`.$ _na&1*$}(%@ % %,$&' !ߵ$$(%@(%$` % ҈ߦߧ߿'ߩ@% $:?"E$(aL %'tx` %0% $y߼߱߳%&߿߰ߵ'0$%$%$e $ $%$P%ꐉ$+ f!c0c@`()% % %'H'H߼߰߱߳'0'ȯ̏d''\8%$)&%` %%J 8@x'$d߭$ d$z8%-h#`* 0 ` % '菧ȯߤߢ'߿ $ h` %ȏߥߤߢ'߿h%Y`%X߼߰ %߱߳'0 ߿'А<$B % "!$߼߰'0  %P'9h %0% P(!߼߿B߰'0+<'$!!! 8' ߿$߼'0P'9h@ %0% "(!߿B߼'0+<$c0#!"D<'`8$B@"!!%x%p%h%0%  ߹  %(%0%8%ߣ0@% ߴ߿@߼8'PH@ߦ0 @%(8%@X%t P%H%ߥ(0%$  (%tߤ'P ߴ( ߤd ߿@'<'?!P'9pp 8%߿߼'0'<'?!P'9pp $߿߼'0'PXxTh%'p%'9P$%  $߿@c@%3#`(! Kp('(!P % F@ ߿߰x߱p$߲h߳'@ %H '$@@Mߨ`)P߳ %߱X$  (IߨPxxP%'h %'`x%)z$z%kz q0  $(ߧX(!'9yЌ  % t@%߳ 8'߿%߰x߱p߲h'Hx %P%x'XF%)z`߳ $z@߿߰x$߱p߲h'߰x߱p$߲h߳'0!#ߨ`&c&(h*`;ߩ`2!0߱P%)iH!߳ H8ߥ0̠T'9'x %  h@3?PT 4'Xl'X'P D$Pߥ0'9y@0%ߧX % t@@%H 8'x 8'Xߡ@ߨ0$ߣ8$%r!h0߳ 8'ߢH߿߰x߱p߲h'$H'<$!`!!p'%x 4% 4'*#&'`N`h؏Џl8ߨxX$ߥX̠pߤp' F@xh@ %' A'$@z%@? %0\&1' 8@%&(@*/ %' D%@%@ %' %$@@7` % # %@&1߾ߵ߷ߴ߶h߳߰h)' 8@%' 8@%߲ ߢ`߿߼߰߱' ' 8@%ߧxߣg!ߧX$gX߾ߵ߷ߴ߶߳߰h (ߤp@@%H%x'p0%ߤp $z$`߾ߵ߷ߴ$߶h߳߰h߾ߵ߷ߴ߶߳$`߰h߳Xs߾ߵ߷ߴ߶h߳߰h'0p<x'`?!T'%`$'9Ph%$  %߿p@@%#X(! {P'% 4% 4'߷X$&Cp*&`!W!p2߳߷߾ ߲߳߷߾ % (߲@@% %H%x'p0% ${'߶ 8%' 8%߼x߰`߿p %߱Pߴhߵ'0$ "@ %@%3@!&Ϗ' (% %' F%@9@%,@ % '$@@⏧$Ќ!#&+a @ %' #`@@%`$Ќ+D@ % %@̎x %P%x'X%)z߲ $z@߼x߿p߰`$ߴhߵ'߳߷߾$߲߼x߰`߲$ߴhߵ'Џx %x@%${ ${߳߷߾߶ % (߲'@`PXH@08( ppx%% F'@h߿$߰x߱p'p %ߥ F'@CЏ'$ 4,' ߤh'X@H %ߩ !x % 0%x8%ߪ%k{$| j( ߡ!  %߱'8%  0%ߣ#$ ( %@0% %8% %'X $' 8%' 8%' 8%߿ߢ߰x߱p' 8'߿$߰x߱p' %'8%ߦ  %Տ,ߤ ' @ߦߩJߣ$$AP&ߡj0 *H 'Xߡ /ߧߨ0ߣ  ߣ*H&ߪ$  )P ߡߣ``H%ߪߡ 'Xߣ`'X$@081)(+ߪ08ߡ( $ߪȏ$#ߣ `.'Xi81)(xx'x @% %$ ${H${0jߦ P%$ (ߦߪ0ԏ8xx'x @% %$ ${${`jߦ P%$ 0ߦߪ8@'X9ߡ ߣ@`'X2ߩH 'X-ߤh !ߥ,J@@Ќ$$ߩ`$ ߡ$P&* ߩP*H ߡXHߣP`'X$ @1)*ߤh !ߥߪߡ"P ߣ`&'Xxx %' 0%X%x%J{%){ߨ ${$Xߤhߥ #,'@-Dߥh %@'Dߣ H%`ߪ@ُ$@0!## "ߤh@%ߢ# ߩ ɏ ( %@@% %'XxH%$ߦ ${ߣߤ ߥߪߩBH 'ߤh #`$@Dߥh X%ߣߡ"  '(8@%%0G% D%$-΀6`%' %@'&s&q$ߵߴ ߿$߶ `%߱8߳(ߴ ߵߣ0߿߶p߰@'p %@x&bxߤ@%$| $|߰@߱8߳(߿ߴ $ߵ߶'p%'h%' % A'$~ߡ 2$"!# 4 % )#`d A0$G  ( %(!$ < ߿߰'  pߤߥ F'@ h߿%߰' 4 %揙@ %' A' 8'Ǐ' <8$! !!|0(%% (%G*#(8&8#`0G8&8#k' 8p@(% % F'߿(@=$$!{#hTT*'$%'@%'0% %@E %@&7!90%G  %@+&R&sq* ' 8'߼8߰ ߲߱߳ߴߵ߿(߶%߷߾0'`߼8߰ $߱߾0'`߼8߰ ߲߱߳ߴߵ߿(߶$߷߾0'`߼8߰ ߲߱߳ߴߵ߿(߶$߷߾0'`܏x@ %0% 2$|@߼8߿(߰ $߱߾0'` %'@%' ؏@L߱߾0߿(߼8$߰ ߴ'` % (%@%. % 1h$@0% % (% %7!9'0%  %@ %!$! 3!߼8߰ ߱ߴ߿(ߵ$߷߾0'` (% %$c !ԯx %  (%k?!9'0%  %@x߼8߰ ߿(߱$ߴ߾0'`  %߼8 % I<'$!!! @߿%߼'0fD8]$, ߤ' bЌ$,_?( ߿$߼'0<'@$!`!!,0H8 '$@@߿H$߼@'`0c$$f-Џ,ߤ0 '@$@0: ߤ0$ @ ߿HЌ$$߼@'`40AD$C.$`F-GT'9ߤ8ߥ0 "'߿H߼@'`?߿H߼@'` ߤ0AT߿H$߼@'`'9ߤ8ߥ0 %'߿H߼@'`$?߿H$߼@'`ߤ0 (AT߿H$߼@'`'9ߤ8ߥ0 %'߿H߼@'`$ߤ8 '0$A '0ߥ0C!'0 @@ ߿H%߼@'`߿H$߼@'`߿H$߼@'`'8 0%((%% 0%߿(@C@%@ % $@M@\ @%8 %`(% ߦ$ P%I+@(%@)@/ ` % % ߳@ߤ ߱8@ߣ$#T'9@(%ߤ %0%$߰0A+߿(%߲ 'p @ %߿($߰0߲ 'p$ ߰0$߱8߲ 'pߤ`(% ߦߣC8$  %߿(߰0$߱8߲ 'p @ %߿($߰0߲ 'p<'$! !! @߿߼߿$' ߼%' <'$!!!\ %\@ % ߥ('0ߤ 4@߿߼߿$'0߼%'0<'$!P!!%' 4% 4'؏$(% <'$ (%' <߰T8%T'9''߱ #$ @% 8' 8'߿߼%߰'<'$!!! %@3߿Ѝ8a]$ ,!! i߿$߼߰'  %ߥ <$߿ߣ` 4'$ߥ <'T8%T'90%' #$ @% 8'߿߼%߰' %߼߰' '@%%X%% %ЌA؏,% % '$ @@߿% ߰`$߰߱@%߲߳'0` % (%$ <%߿0ci߹ %ߥ$'`@% ߱߿߲߰߳'0  %@߿%߹ %$'ߥ `@%@%@ @%ߤ ߱߿%߲߰߳'0$'ߤ <%ߩߪȍJ J  ߤ@D$D '@7Dߤ '@3 ߲$%ߤ <@(%ߡ FTߤ'9ߥߦ #`8%@@% ߤߥߤ $ߩ߰߿ %@߹ %$'ߥ `@%@%x߿ߤ ߥߡ $  ߤ@Dۏߤ$ߥ <%ߣic؏ߥߤ $ߩ߿)@(%$ߤ <%Tߤ ߥ؏ $'$<$B%"!$ %T$߼߰'P %ߥ <$߿ !ߥ@߿%߼߰'P # ߤ@߿%߼߰'P'9 %ߥ@߿%߼߰'P(%'$<$B%"!$%$$߼߰'P % <$߿߼߰'P %ߥ@߿%߼߰'P %ߥ@߿%߼߰'P'X % %0  @ Xߥ %$ ($@߿$߰ 'PߧD'L % @߿߰ ߿$'P߰ %'P<'$B@"!%'% %@| ( %@% ( %@@% %xH%'ߦ 2$|߿߼$߰߱' $@@%  | ( %@% ( %@@% %xH%'ߦ 2$|߿߼$߰߱'̎$$ 1h߰  ߱߿%߼߰'<'$B"!%'% %@| ( %@% ( %@@% %xH%'ߦ 2$|߿߼$߰߱'\ @@%` | ( %@% ( %@@% %xH%'ߦ 2$|߿߼$߰߱'̎$$ 1h߰` ߱߿%߼߰'<'$B"!%'% %@| ( % ( %@@%xߤH%'ߦ 2$|߿$߼߰'''߰ 0$ 1h'߼߿߰'%<'0$! !!(%(%' $%@8ߤ 8(%@% h %$  %@0@%߰8(@ % $@  |8 ( %@% ( %@@% %H%x'@0% 2$}߼0߿(߰8$߱ ߲'`  ߿(߼0%߱ ߲'`  ߰8| ( %xx@ %P%@0%x%)}0$} ߨ 2$}߿(߼0$߱ ߲'`<'0$! !!(%(%' $%@8ߤ 8(%@% h %  %@*@%߰8(@ % $@|8 ( %@% ( %@@% %H%x'@0% 2$}H߼0߿(߰8$߱ ߲'`߿(߼0%߱ ߲'`| % (߰8xx@ %P%@0%x%)}0$}hߨ 2$}H߿(߼0$߱ ߲'`<' $!~!!(%( $'@߿($߼ 'PXߤ @| (ߤ (ߤ@@%xߤH%'ߦ 2$}x߿($߼ 'P߿(%߼ 'P<'$!}!!| (@ %$ 1'߿%߼' %p%$A'%%$@%%%4% x߱߰'x@%x0% $} $}߿ %߰߱'%-$ ߭LM,$B  %,@(% 0 \0%@%@C߿ %߰߱'菙p0 ߥ F'@%( 8'ߢ(߮0ߤ$@߿ ߣa%-$ ЭL@ % ߥ鏙߭ߤ''߰1 (͈ @P%X%'@%x' 0%ߤ $}߿ %߰߱'ߦ@ %$$00+ ( ߮0ߤ@߿ ߬$ }-L ߤ߮0ߤv߿ 4ߤ H߰x@0%H%''xP@ $}ߤ $}߿ %߰߱''<$!z!! %!$  %!ூ&1C5A߷ߵ߱߿ ߼'@'(<$!y!!@0'%8 $" % %%$@' @%@b$ Ќce% @%篂ߵ ߲(ߴ0߿8߳@߼߰߱'P'@X8<($!y0%@%!!h%px$$`%F!1 0c`''$@0% %"1J0@.1)@ MW,  %&r'0% %ݏ $ ( %x %8%x%$ J$~@$~KP& J0 &x0%% $~& >$ X ԏ 0ď"H 00@8% %x'H%ߨH $~ %' x@%%ߦH $~& 01ďP 00@8% %x'H%ߨP $~x %' x@%%ߦP $~&'' %2 0 %' x'@% $~h$ ߵ߷߿pߴ߶߰x%ߩX @ <߲`߼8߰0߱(߲``%߳@߾h'\ %(%p $0% %DP`P$'8 x %@D@ $'8 %'80%JP!% @$ ( %@0% %x8%% $~菙D % (%߿pߩX %x0%%p $߿p'௠,($ (H< $!u8%0%@%@ %%!!֮ Ȯ 4'0$ ` ߫$`%phXPߴ$>`0%߫`# ``!p#pp!߭h#߮&p*&&$ |$ 2$&kX%$ <ka~$l" ߬&߱!&ߣ?#%x#0kx!``%%!C` ,!߭,`# ``!%$! 0%&(ߧ(%+ %$$#'!"#'!A$$d$a#'!"#'!"$$$ጢ߫߭߫`߬P%k %P`%` H h+ ` $ <e$ & X$dXphX`͏߬Xߴߵ߾߭h'ߥh  %@>$,.*$%$ &$ &a׏ $  ($,$ `&$-X ,Tߤ(% 0%' '9''$ '(@H%x@!`@(`( H %, h+ ` @%4,XTߤ(%'''9H%' '($x@"߳ߴߵ߾߷߳ߴߵ߾ H߷ h]߬߮d߫h`ߤh H߫h`߬pߤp H߫p`߬xߤx H߫x`߬߭߫߱$`%+! ~$& $ (`&& , $ ( H %,Tx+p ,'('ߤ@H%'9 0%(%', '(x@%@ߴߵ߾؏` ߬p 'ߤp  %@c$    %(%@% ߳@&@% (߳ߤ`  x߫%%` p%0!߭pp!W 'ߧ`0%(#ߩߤ% dH @O&'0 8%߫߭&Rh!&`߫H <߮.p* ߳@%'0ߤ!% Feb$ |$ & %x%@%ߦ߫+X*%!`߿x%#?!a$c8 $!X!%`%߭H $'  '@ ' H %߮ Hߤ & $(% '`%&߳ ߤ$߬߫@%'0 8%߿ȏ H߿ȏ  H߿ȏ(` H %߿߼@%߰0߱(߲8߶H߷ '  4%%0tx0%ߤ $0x$  %@m$  %@)@ %$ `%,$ `+X @%, H@ %W$ H %߬ ߳ߴߵ߾߷ Hߤ߫h$  %@@ %$ `%$X+$p $$%*&(&( H %!$(%ߤX @%@,$ ǯ (ߤx@0%8%ߤ $Ix (ߤ|@0%8%ߤ $>$@ % `%`+$ X  (ߤx@0%8%ߤ $X$x (ߤx@0%8%ߤ $x (ߤx@0%8%ߤ $ xx$}@%ߤ$H $8x%߭,`# `k`!$,`# `k`!'ph8 %0"@0#0!0<`%gH(!''X' P P%H ' )@@ ߣH@%(@@%0c` ߥ@=ߡ0 ߥ8`Dߥ8߱  #ߦ % '  ߰h߰h H % H %߿P H %߿P%߼`߱X'ݏ ߧ( ܏@(|0%ߤ $||8%$ƀPߤ $0$ ||8%$ƀߤ $p$8ߢ(߿P߼`߰h߱X'<$Be"!&Ќ9|,n'90@0!`"|"|$B$"($"0"|$B"|$B$"8"|$B$"@"|$B$"H$"P$"X$"`$"h$"p$"x$"$"$"$"$"᠌"|$BЌ"|$B"|$B$"ᨌ"|$B"|$B$"$"$"$"$"Ќ"|$B "|$B0$"$""|$B@$"$"$"$"$"$""|$BP$"$" $"($"0"|$B`$"8$"@$"H$"P$"X$"`"|$Bp"|$B"|$B$"h"|$B"|$B"|$B$"p$"x$"$"$"$"$"$"$"$"$"$"$"$"،"|$B$"$"$"$"$""|$B$""|$B$""|$B$"$" "|$B$"("|$B $"0"|$B0$"8$B@$"@"|$BP"|$B`$"H$"P$"X$"`"|$Bp$"h"|$B"|$B$"p$"x$"$"$"㐌"|$B"|$B$"$"$"$"$"$"<'$!a!!|,n0'9 0!@|, ߿߼' |߼' $B|߼' $B|߼' $B|߼' $BЏ|߼' $B|߼' $B|߼' $B0|߼' $BX|߼' $Bx|߼' $B|߼' $B|߼' $B|߼' $B؏|߼' $B|߼' $B|߼' $B|߼' $B0|߼' $B@|߼' $BP|߼' $Bp|߼' $B|߼' $B|߼' $BЏ|߼' $B|߼' $B|߼' $B|߼' $B0߼' $BP|߼' $Bh|߼' $B|߼' $B|߼' $B|߼' $Bȏ|߼' $B|߼' $B|߼' $B|߼' $B0|߼' $BH|߼' $B`|߼' $Bp|߼' $B|߼' $B|߼' $Bȏ|߼' $B菂|߼' $B|߼' $B|߼' $B0|߼' $BX|߼' $B|߼' $B|߼' $B|߼' $B|߼' $B(|߼' $B@|߼' $BP|߼' $Bh|߼' $B|߼' $B|߼' $B|߼' $B|߼' $B|߼' $B|߼' $B|߼' $B(|߼' $BH|߼' $Bh|߼' $B|߼' $B|߼' $B|߼' $Bȏ|߼' $B|߼' $B|߼' $B|߼' $B0|߼' $BP|߼' $Bh|߼' $B|߼' $B|߼' $B|߼' $Bȏ|߼' $B菂|߼' $B|߼' $B|߼' $B(|߼' $B@|߼' $BP|߼' $Bp|߼' $B|߼' $B|߼' $Bȏ|߼' $B菂|߼' $B|߼' $B |߼' $B@|߼' $BP|߼' $Bh|߼' $Bx|߼' $B|߼' $B|߼' $BЏ|߼' $B菂|߼' $B|߼' $B|߼' $B0|߼' $BH|߼' $Bh|߼' $B|߼' $B|߼' $B|߼' $B|߼' $B؏|߼' $B菂|߼' $B|߼' $B(|߼' $BH|߼' $Bh|߼' $B|߼' $B|߼' $B<$BWP"!9|, 8'9@8!`$"䨌"|$Bh$"$"$"$"$"$"$"$"$"$"$"$" $"($"0$"8$"@$"H$"P$"X$"`$"h$"p$"x$"$"$"$"䘌"|$BH"|$BX$"<$BV"!9|, 8'9x@8!"|`$B`"|$Bh$"Ȍ"|$B"|$B"|$B"|$B0"|$BH"|$BX$"䰌"|$Bx"|$B"|$B"|$B"|$BЌ"|$B"|$B"|$B"|$B($"丌"|$B@"|$B`"|$B"|$B"|$B"|$B"|$B،"|$B"|$B"|$B "|$B8"|$BH'<$!T`%!!(%|D)G % ߰(  &@ %ߥ0% "?!߿ 0߰߼ %߱'@ߡ @% t|߿ ЌD  ߤ߿ <'$!SP!! 1h߿߼'0'(<$BS (!%%  *"! \ % +߿( ߱c &$@ %ߥ 0% ߿(8!߱@Y  % ߲߿(߼ ߰ ߲'Pt| $ӏ ߤ@%߿('<$BQ(!%% "! fT8*%!߰!%߰`߼߱'@'9@ 3 %߿ t| $߿  &$ ߿ @ %  \ %ߢ߿ @(%Ӯ'< $BP(!%% ("!# gT81"(!@*! $0%0ߥ !'ߨ߿0(8!߼߰ ߱'`'9@0 3 %߿0t|0 $߿0ߥ %0( 2(!ߢ(߿0߼߰ ߱'`0 ߤ@%߿0'xph`XPHD<$BO (!%'H \"!B CGT0T8($%&p$& "!=߰A1*߿( @ %B1(! 2"( ߿(J߰TP!ߴ0P!&p$&@@%0%H% '%)%$߰@߳8@߳8߼Q߲߱ ''9@( 3@ %80߿(߿(߼߲߱ ߳8ߴ0't|( $߿( ' %    %߿` ߰'   % ߿<$cM0#!" %<$cM@#!%<'$!L!! @߿߼'0t|ߥ $Hߢ߿' <($!Lp!! @%@߿߼(%߰ 'P(@ $ߧt|ߦߥ $h߿<'$!K!! @߿߼'0t|ߥ $ߢ߿' <($!K!! @%@߿߼(%߰ 'P(@ $ߧt|ߦߥ $߿<'$!J!! ߿߼' <'$!J!! ߿%߼'0%($ $  $$$$<$$BJ@"!'T&T$Ь0$,"T#T$B׀,$c0'T&T$0$@,'Ќ<$!I%!!!%d %`t| $d%e߳' %$ ߿߼߱'0!'<$!H%%0!!( 0&%*@ !&& % %&'߰ ߿(߶0&% TT߼&p50&04,߱ߴߵ'P %( %߿(&<'$BGЬ"!% 4 %߿߼' @H* $I!B%)@C%'p'<0'$!G 8%!!@$@ @@@@@ @@@"p@%8מ`@#(&D ׆hׅ8!F!!&F!O$%$BD(A F!((!F$C F&$c묣`h`( $|x@%'@ %$& %HP %X %$ '%! %%|@0%&Rg $0&s % %V"! %$ |8%% $X߲H߳P %߶X% ߰p|Q !%D&ߵx $߼0߱8߿`ߴh%߷(׾@'% '!$"!g!b!'<'D?!T'9% 5< %ߩ!$)"$!H!)߼߿ % %)  %%%$($߰'0߿ %߼߰'0' <'C(?!T%'9%% 5< %$ "$!H!)  %)  %%%$f$߼߰(߿ ߱ %@߲'P %$ E $DPߧ0!FȌ@% (%@ $D FA2%* ߼߿ ߰(߱@%߲'PT'9 8 %߼<A4!Nm $00f$C!B@ CeB@%<A4Nm'% %$  Bd$C!B<$!B!!@HB@$($  ߤDߨ8!GP@ H$ca*߿( ߼߰'P߼߰'PT'9 8 ߢ ߿('(%%(%8%0 %hh!̠ $3!`X%0%`%s(@`P%@H̀ P8% % +!!!A! A!a!!!% !!!!! A!!!a!%, .!+!d1!!2!" !#!$!%̀!% A!a!(ʍ 8%(P% %߱8߰@h%߿HX%@(%@% ߲P0%x%``%p%ߩ &# @!"@!!@!3@!H@!h@!@!(@!@!0!f!C!"!a!Ә!<A5Nmhߩ# !$b)"$!H!) ߳ %)  %%& 8%$$"$T߳ %ߴߵ'p%ߴߵ'p% 8% h%߱8@x%P%߰@`%%߿H %`%߲P`X%@p%P% 8%߱8`%߰@H%@(%߲P h% %0%% %߿HH%('&$ #"!% P!P!P!P!jP!%) JP!*P!-P!@%'(0<8$!=0%(%%!!`(%H% X %1'0sX!̠ $4!h%%hx`%(@K(% @P̀ X% % -!h%!!A! A!a!!!% !!! !! A!!!a!%, .!+!1!!2!" !#!$!%̀!% A!a!(ʍ0%``%X%@(% P%%x%@h%8%߿P% @%߰  %%߲X%p% *@!@!@!@!!w!!!7!!w!W!7!߱!߷@! <A4cNm $A$pX!k`ߦ`8%k``8%%i P%!%)$%JU@!߼߰ ߳0ߴߵ8ߢ߶('@`%ߦ$(P  $V(!E@ H(@%߿P 0%߰  P% W X1$`8%sX!߰  H$  $ (%)" D`%@%̀%b̡$ aaa a a$a(a,$c bYa$ aaa a a$a(a,$c `bٌa``%H% 8%!'!( #" !$((#,%$BC*`.߼ %߱߳0ߴߵ8߶('@x% P%%`%` %h%߿P%0%߰  %X%߲X0`p%%`%%߿Pp%h%@(%߲X@@% P%H %%߰ %ߤH``%H% 8%T'9 8 %߿P % e(!E(!E(!%(!(!$ (!(!%(!%0% %  $(,<'$6%!t| $߿%߼' <'$6%!t| $߿%߼'0'% d  g@@%4b %0(%H H!̡ $0&8%( %$ %#%@@ @@@@$" #۬      A$A @C@@8%  XPH@80bc a$$cc b$! a$ XPH%<A0`6Nm`!(ߡ(&ߵ0@ߡ(.B %X%0%@%`% % %@H%@P%^!!!a!!!!!! 1! !$`!(l!,C!"!!!7((($l`!LA@ߡ(Be(%8%$HV0v$Mu 2H!@%@(% $! P%0%,X%( m@0%h,p(f$e dcb%g aX%*!@P%A!ga!m !n$!y(!o,!%x b! A!l!!! !$!(!,!!' !i"! ݍ`%X%p%0%x%`@% %L((($T'9 5<&De$($ߵ0߷8ߴ@ߡ ߾H&l߶P ߲X߿߰߱߳'p1 8%ߤ ߵ0߷8ߴ@߾H߶P ߲X߿ #`(%$ F0!&0!0!f!C! "!`!0!T%<'$!1p!!%('< ;6R$(@<e#4B@@e!'!h!$0*r!" b HP#X#@H%@`0%  %(%0%8% '菙 ;'<4B@HP#߼߿߰ ߲($ߵ'@%fDH!߯' P H @ 8 0 ( <$!009-%|dx|dd$ 8  %|d|dep$8 |d% %|dƼ|d缸$< ' @I% %`(%|dƼ'$< '@ %$.l @ $D!C0c` '@8% %`(%|dƼ$<  %|f %`(%0%$<  %`(%0%|d$< 0%@8% %`(%$<  %`(%|dƼ'$<  %|f`(%|dƼ8%$<  %`(%|dƼ8%$<  %`(%8%|dƼ$< |dBf8B@(%Td( $ $ $|d!f8#߿ P߼ Hߴ @߳ 8߲ 0߱ (߰ ' `'<$!-d9-|df@ ߿߼' '<$!-(9-%|d$$ @%7' (% %'p @%' %(%|dƽ8% @@(% %D (% % @$ @%  %%$H  %|d$H ' ߿߼߱߰''<$!+9-|dBPD|dcheFGHijk |dBdD|dcepeFGHijk |d!f8 ߼' <'$!+`!!d %߿߼'<'$!+ !!0' '<4B@߿߼' C!<'$B*"! $<`߼' 4 $߿<' $!*`!!0'% '߼ ߿߾'@'<$!*9-%߼' '<$!)9-|d0%t $߿߼' '<($B)"!% % l0%@8` % ߥ@߳߿ $߼('PߤߥC h߿ %߼(߳'Pߤ`(% lߦ4@ߩ߳߿ $߼('P) @*߳%߿ ߼('P|0%ߤ $߿ $߼(߳'P<'$!(`,!!$$''% 4,e*`$''$4 %$  ,"* ߿%߼߰'0',$4$  %'$',$4 %$  ߿<'$!'`!!% 4' $( 􏙍\$0%'ȬU % ۄC<%$='(% %'@(%0% <% %$'%8! Ռ$S!R%@@(%F&s& %&$$' %dH%$aT0%' l%0߾(߷ ߵ߱߰ߴ߶߳' 8߲߿߼'@'0<('%?!T'9 %'8 ?%$@%A$h*`\B@%b! % `@@%8D(! %(! $@\߿0H@ @!@H<$8% 0%'ȎD Ռ%R@$ߴH  %@%b !@ $@%@ %  (%r0!$=$߱ (%Tߤ'9߳@8!@(% >߼(߿0߰߱ ߲8'`  $@%0@ %  @%2$߼(߰߱ ߲8'`<'$!#%!!%߼߰'@l %( $=@ %@&߿(P(#%%߼߰'@ $@ % (% ߦߥ0߰ ߦ$0! % =   %߿(%߼߰'@%߼߰'@'<'"?!T'9' ?%$(߿A+ !$$$T'9 >(% (\$0%'Ȏ$ ۄ%1 $ߵ(߿߼߰߱ '@߼߰'@'<'!?!T'9 ?'$߿@0%A d!cd!c$=$d߼ %C!B'0C!$B%߼'0߿'<$! $!!%% %2BC%t|t $H @%߿ 2I  ( %$ 0% ҈'ȏ0@(% =  %߿ 2A@ 4 = %߿ ߼߰%߲߱'`P%  %1#p  %1 t| $x#)I  %߼߿ ߰%߲߱'` 򯁕'%% `$B$!8 %@Cd %`%$ % %8@*( !% ߿! ߴ(@!ߵ߲߱ ߴ(~߰#ߵ$d(l߰(!߱ n0(@(!!( B$!@( H%@a(L %!/-.' "#$& %* A$/%K .(%&% $#"'HGF EDCBA %i HLmGFE DCBAhgf edcba %* hlVgfe dcba!(& %$#"' A%K !,ʭ(@X%'"#$% &o nmljh ayonmlj hayߴ(2!߲ ߱ '@ ߱  $@%@ ߿ %@(% 0 ߲߿߲ @%@!ߵ߰ 8%`h% X%H%@H% 8%- ,(&$# ".$! -,(&$#"%.$=%`<`% .NX!k$B`1%i`P%$@%H%K!%+K#%kK&%K'%K!%+K#%J%)%PkKNX!0!NX!%$<'$!`!! ߿߼'<' $B "! $B:x߼ ' 0  '(C߿ `$B:x' @ @@%ȏ $:x ߿ ߼ ' 0@ȏߥ  $:x߿ $߼ ' 0$B:x'8<($BP"!%% %|@S@%*@D@D$@c@ @%@$D C@ %ߥ@0% "(ߦ@!H' (% %2$ @'|  % (߲8A | % (% E % (%@ % 8(%@(%t % $#߿$c߰` #ߢ ߼(߱@'p t0@|ߢ0*  %߿ % h߲8@ ߿߰' 0<8$!!!%($%%' 1h`%$'د 1h`%'$ @%B %`(%$B خbc$c߿`c%<<G8$<@'߳A$߼8߰(߱0߲ '`H@$ 쏙 % (% ߲ ߿ ` %߿ % (% ߲ ߿'@8ph(0X<`%$cPP%%x%1aH5d%@ *#!h(08p&$P(%h(%0 %@8%@%H%& M%@ % %@2&R$E %$&1$&s $ T$0%߿@'9+p' %$ Jܯ߿h߲pߵߴ@%@$߳x߼Hߩ( WP#d߰P\߷X `߶` %߱8't|% $߼H߰P߱8߲p߳xߴ߿hߵ$߶`߷X'T'9p %8%ߦ0 A'@%@߿h$ #| ( %@ %@%|'0% 2$$߿h plB$Cl$@a(H 1 %l߿h'X8@THP'9 %0 BH%@%@߿ ߡ@!$#߰P߱H@%߲X'T'9+pߤ8ߥ@ J0%@%@߿ \'$ % 4@%ߤ8ߥ@Tߦ0 '9p8% A@%@߿ ߡ@!$ )@*#( | (ߤ8|@ %ߦ@@%' 2$$߿ ߨ@>HT'9+pߤ8ߥ@ J0%@%@߿ \ %(% 4'ߥ@Thlߤ8'9p#(ߦ0 A8%@%@߿ ߡ@!(* * ` hl$' %0# 40#ߩ($`'%& %"0 40#ߡ@ $?߿ plbH$I l$@(H % 1@%lpl"$Hl$@СH 1 %l߿ ' T0'9( C%߿(@@ %ߡЌ!$#߰0'pߣЏP`$d' 4HߩЍ)$ *&8` %@$ h %l(! %&s0#$ 40#`߳@Xߦ' 4| ߢ߱8߿(ߩ ߰0'p`T'9+pߤ ߥ J0%@ A\plh3%l$ *''\$$1 %0! 4$Tߤ '9ߥߦ C8%@lߣ p%*#H*I (ߪ%  l$(#J$AȏTT 4P'ՏH 1 %ɎlH 1 %l %' 4$D$'0%8% 10@%x( ! \tߡߩ* ))l p%+`%l$a lߩ%J lI% H+ %  l$#lߪ$!l N)l$cl a l%) l #l$!l*\ %(% 4' h$l' % %0#0# 4@t|ߥ $(D$'0%8% 10@%x( ! \tߡߩج* $"))l p%+`A%l" lߩ%J lI%+`;%l$a lߩ%J l Cl$!l T*l$cl a l%J lI h$l' % %0#0# 4@t|ߥ $(pH 1 %nlH 1 %vlH 1 %$lH 1 %l'0T@'98( D%߿8@@ %ߡЌ!$#߰@'ߣЏP`$d' 4H ߩЍ)$ *&H` %P$ h %l(! %&0#$ 40#ߴPXߦ' 4| ߢ߱H߿8ߩ ߰@'`'%A%JT'9+pߤ0ߥ J0%@ A\plh3%l$ *''\$$1 %0! 4$Tߤ0'9ߥߦ( D8%@lߣ p%*#H*I ( ߪ%  l$)#J$AȏTT 4P'ՏH 1 %ɎlH 1 %l %' 4$D$0%8%ߤ 10@%x( ! \tߡߩج* ))l p%+`%l$a lߩ%J lI% H+ %  l$#lߪ$!l N)l$cl a l%) l #l$!l*\ %(% 4' h$l' % %0#0# 4@t|ߥ $PD$0%8%ߤ 10@%x( ! \tߡߩ* $"))l p%+`A%l" lߩ%J lI%+`;%l$a lߩ%J l Cl$!l T*l$cl a l%J lI h$l' % %0#0# 4@t|ߥ $PpH 1 %nlH 1 %vlH 1 %$lH 1 %l'0T ('9% ED%@%@߿ߡ!$ *߰(߱ @%߲0'`Tߥߤ'9+p0%$ Jܬ@@%Tߤ'9ߥߦ ED8%@@%lp$#1* a ߩ$Cl$*a#$hݭ ߿H 1 %l'0T ('90% E%@%@߿ߡ!$ *߰(߱ @%߲0'`Tߥߤ'9+p0%$ Jܬ@@%Tߤ'90ߥߦ E8%@@%lp$#1* a ߩ$Cl$+a#$hݭ ߿H 1 %l'0T ('9P% E%@%@߿ߡ!$ *߰(߱ @%߲0'`Tߥߤ'9+p0%$ Jܬ@@%Tߤ'9Pߥߦ E8%@@%lp$#1* a ߩ$Cl$,a#$hݭ ߿H 1 %l'8T 0'9(% F4%$@@%ߢB$ L G ߿(߰0߱ @%߲8'`Tߥߤ'9+p0%$ Jܬ@@%Tߤ'9ߥߦ F48%ߡ@@%$p% l@*#( G$Al$ .)ߡ#$$ ) hߣ$hՏTʮH 1 %lG$Al$ -)H 1 %l' T(0'908% F%$ $ @ @%ߢB$NJI$ L M ߿8߰0߱(@%߲ '`$ $ Tߥߤ'9+p0%$ Jܬ@@%Tߤ'90ߥߦ F8%ߡ@@%$% @*#"( ߩ$$!%ߣ$h*ߩ!0ߡ#$$ ) hߣ$hӏTߩ$!ϏTߣ$hˏT$  pl"$Cl$/apl$Al$ 0٠)plb$I l$1ѡ(pl"$Hl$2ɡH 1 %ߎlH 1 %lH 1 %lH 1 %l'8T 0'9(% G,%$@@%ߢB$ L G ߿(߰0߱ @%߲8'`Tߥߤ'9+p0%$ Jܬ@@%Tߤ'9ߥߦ G,8%ߡ@@%$p% l@*#( G$Al$ 4)ߩ#$ hߡ$#֏TˮH 1 %lG$I l$3(H 1 %l'8T 0'90(% G%$@@%ߢB$ L G ߿(߰0߱ @%߲8'`Tߥߤ'9+p0%$ Jܬ@@%Tߤ'90ߥߦ G8%ߡ@@%$p% l@*#( G$Al$ 6)ߩ#$ hߡ$#֏TˮH 1 %lG$I l$5(H 1 %l'8T 0'9 (% H%$ $ @ @%ߢB$ M J K ߿(߰0߱ @%߲8'`$ Tߥߤ'9+p0%$ Jܬ@@%Tߤ'9 ߥߦ H8%ߡ@@%$ p% l@*#( ߩ$ !!G$Hl$9ߣi$ ` !ߨ$  ҏTߡ$ #ΏT®G$I l$7(H 1 %lG $Cl$8aH 1 %lH 1 %l'0%$$ $$ %(%%  %TT8T %'9"``(%@0% 8% H߰ߴ߿8@%@1߳߰2߱0߲(߳ߴ%ߵ '`T 0%8'9+p`(%$ % Jܮ`@%@߿8T'9  %`(%ߦ H 8%ߴ@%@߿8$ 2$$ $H%! ߰Ѯ` ώ2"l#pb!߰$I)l$:("l!p"߰$H(l$;"l)p"߰$C#l$<a"l(p߰$A!l$ =٠)H 1 %"l߿8H 1 %"l߿8H 1 %"l߿8H 1 %"l߿8'8`%%$0@%$(% $$X$ H c |H (ߤ@ %|@%'& 2$߿H߰8$߱0߲@'&El($ Fp$P+@$CldAl$!Al++P+@$Al$ +Jl%JJl#CAl$!Al+ \+Jl%JJl#CAl$!Al++$(T'9+p (%Hߤ J@0%߿H߰8߱0ߡ(A߲@'T'9& (%0%Hߤ I@8%$@߿HA(T'9+p (%ߤ J@0%@߿HTߦ '9p@8%ߤ (% A $@߿H!$J#(ʏTߤH% <$FP@@%$8% &$@߿HA߫Jd(KP!* ߤH% 8$BP@H%@%$" &$@߿HKߪCd(j!# ߤH% 4$ MP@@%5 P&$@߿HߪFd0!$]1$+fPt| $ߢP$߿HJ{(HHP 1@ %ElߢP$I߿HHHP 1@ %ElߢP$J߿H hߤ| (ߤ؏|@ %$ 2H$x$a߿Hٮ* '8(0(!!$ _H@%0!@%%  d%H(H!)1)@ &bT'9+p` % (%0 J@0%@ !$#:|T'9+p` % (% J@0%@ ߰8 ߿_߿߱@߳H߲0'y@ߥ &d @y|G `Dߪ  ,%T'9p ` % (%ߦ( A@8%@ߡ!$!0A"$CQ$ Ii| (` %@ %|@%'& 2$߰8߿߱@$߲0߳H'bT)$ *T'9+p` % (% J@0%@߰8ߡDl!Ep$ (+HX 1@ %DlߢX$Al$ >*Ilߣ%)Ilc#$C$ I| h` %| (` %؏|@ %$ 2H$$T'9+p` % (% J@0%@zߡ&$! (` %@ %|@%'ߦ 2$ߩ$h h` %| (` %؏|@ %$ 2H$ Z$@@%$$ߤ 108%Dl(IEp ߧ$P+@(H$Il$#Al$!Al"$P+@"H$Al$ *Il%)Il#Al$!AlT*Il%)Il#Al$!Al"$:P 1@ %DlߢPߧP 1@ %DlߢPߧHX 1@ %DlߢX$Cl$?aJlߩ%JJl)%)I$'P(0X `h%$$ || !0$$+ "%E R&  !0 %E&$ J)KP$-H*H!)1) <Hp T %@3߿p0%' % `j$"A@%D8 %0%8%ߨ( 10(#߰(߸88x!@% \ %t 3 ߲h? ߿p߰X%߳߱`'ߣH`$$ .$N$ n$&|${$\%D.%)ppP@ $}'$30% 3H!)$4H&)0 & I &F"@%9ߩP ߪ@@rX&-k'P & 0@${$}$\0!'&& $,C^߳`AI!C`ߩP%)P hߤ0|ߤ0ߴ (߳؏|@ %$ 2H$X߿p߰X$߱`߲h'%) Pߪ@ߢ %ߴ@#(C`ߴx @ %ߩ & %H+@% qa0 ߰X$ *߱`%߲h߳'#!!0!@ $ )0((!0@$_PBP!J1J@@&0 ߰X%߱`߲h'$'p % `߿pЌ! vߤ0 F F߰X߿p߱`$߲h߳'CA hߤ0| (ߤ0؏|@ %$& 2H(%@%|8%'ߤ0 $H߰X߿p߱`$߲h߳'T!S!H+ #a$ \&&sAcr2&d@ 0'))% ߥ`8% %%J)A$$$B ߨ(Dߤ$$߳x 10(#߿p@ %ߴ߲h߳0 ߰X$% ߱`'߰X2& %߱`߲h'F8@D8% %$ߨ( 10(#߲8r߳߰(߿pxpנ!߲h " ߰X%) ߱`'QG߰X$!%߱`߲h'߰X$"߱`߲h'%߰X$#%߱`߲h'߰X$ )%߱`߲h'߰X$ *%߱`߲h'$0߰X%߱`߲h'߰X$2%߱`߲h'߰X$ !%߱`߲h'߰X$ "߱`߲h'%߰X$ #%߱`߲h'߰X$ )%߱`߲h'߰X$ *%߱`߲h'$0߰X%߱`߲h'߰X$2%߱`߲h'$<a$=cy$ )߰X߱`%߲h߳'$ >j|$=ap$#߰X߱`%߲h߳' $ =*L$ 2߰X%߱`߲h'$=#E$ )߰X%߱`߲h' $&A?$#߰X%߱`߲h'߰X$ )%߱`߲h' $|A1$#߰X%߱`߲h'߰X$ )%߱`߲h'Dߤ 8%$ߨ( 10$E@ %߿p@ 0'3!ߥ&s)&# $!& * $ )&# $!& ͮ* $ )&# $!& * $ )&{# $!& * ' 0<%8$!@'!!D %%(%%@ $@%`߿( $$ ߿( @0%`*ߴ@߼8$ $ $pX*߲ %  %8߰0`(l8!&߰0C$߱$$BAC$$BAC߱߳ ߵ' %@K%kѮK߼8A$!ʮAJ߱權'P(`p<h$BX"!| %%|x%%$! (H*#`PT'@%|'@ %E $j$@߿x߼h߰p$߱`߲X'X %|@0%$ $߼h߿x߰p$߱`߲X'@$H+߿x$E;$ I߼h߰p߱`߲X'%X %8%@0% $߼h߿x߰p$߱`߲X'$!X %8%@0% $߼h߿x߰p$߱`߲X'*#`8*(6 %' $E@*#߼h߿x߰p$߱`߲X'*) 4*! 2*#`  (%|@H%0@%%j%(>@$ $ߡ(  %ߥ( $'@߼h߿x߰p$߱`߲X' ߨ $  ۏX %|@0%$ $߼h߿x߰p$߱`߲X'X %|@0%$ $H߼h߿x߰p$߱`߲X'(($(0&1 T %'@%ߦ@'H ؎% $@^ߥ0@A$ %' Ў%@ߥ0߼h߿x߰p$߱`߲X' ;@(% ߤP߼h߿x߰p%߱`߲X'` %| @H%T%j%E8 ;@(% ߤP߼h߿x߰p%߱`߲X' ; u<6<' 8DT@%@ %'0% TD@IߤP ߼h߿x߰p%߱`߲X'߼h߿x߰p$߱`߲X'ߤ' 8Hߨ % ߩ)%)[ %'ߥ@%'Hߦ8 % ، @$@揙Hߨ ߥ %' Ќ@ߨ ߼h߿x߰p$߱`߲X'߼h߿x߰p$߱`߲X'@%|'P 0%ߤP 2$x߼h߿x߰p$߱`߲X'T'9>ߧH % O߼h߿x߰p߱`߲X' ;Џ@%'|% (%@`؏< ' @% 0%$%$@(@(%&&#&1(a  @&&)&1(( &&#&1(a @&&)&1(( &&#&1(a @&&)&1(( $& 4' (% '@@8%0% (% @߱ @%|'P0%ߤ 2$ ߿$߲߰' ߤ$ 1 8'߿%߲߰'  ' @%(<(<  @ $$$$$ (  $(@$( `$ d#e!C#4F!C!d#e!C#F!$ @! # !`D#F!&##0!'P#&@%|##$ d`% o$Bj$(  A ` (n($$%$ (pp! @X%$p*$1L$'` pC ((!m %k! %' `x%%%, # $!!%b!@%'( p*nh (i'8$ ?@/ G&Hh&e#g0c$l&(#0l#(!,cH0%###%K0! O G'&h0&'#,!$bEA ##%j0! ? G)&H0&)#,#$eC#ߨ@@% ߩHh$z( ߨ@@%ߩHߣ0`X'(*Pp `<7Q?P, 0% 8%T(% AX'9@P @#ߤ8@H @! PߤX$@\߿`"!B9%'(8@$$Np&%Cp#1%p&/p#H7-8 &!#% 0B ? 7E&& &E#,B$!mA!#%(0!/7'& &'#,!$Bm#"!ߨ@@%ߩH 'B @߿`$#ߨ@ߩH`'(X' h*P` $``$''ԯ 'B$$BA' _$'(e#s#߿@E#s!߳' C!' %% 'Gߦ 0#$$<4Q '+< 4!:b 0T'9Eߤ0!((! Qd߿߾'P'T%K 08@H( 'TYS#x!߸ x!$ &sYr@%T$ $ I'&1AH@ %GE @0%&s P`` %@%߿( )  $ $ @0%` % %% ' P`@߿( )`߿(߳0߲8߰@@߱H$'p'pTT߳0߲8'9E߰@ Qd߱H߿߿('p%'HX%8` %@ % &"!!0!  %ߵ`D' % %@R߿8 %' %@L߿8 %' %@߿8 %' %@߿8  %$C߿8P0 $  %$FP0%|&j(`%,(%` % % %@߿8E&R ` %$ %@߿8߰H߱XB A߲(߳Pߴ@ߵ`߶0'a߰H߱X$ߴ@'8ߵ`߲(%(% % %@7eD&s 8 %(% % %@;eD&s   %Q !$s %(% % %@je&s ! $H%< 8% (%$.4$߰H߱X$ߴ@'$߰H߱Xb((! ;(`8(6߳(9DL(d(E$$l%0  D H@8T40'9A<' P`@?TP'9F'L ! Q@/8!  3T߼0߿8ߢ߳('`G%߳(߿8$߼0'`ǏDŏD L8%`دߧ #!A@#@8!8#̯0#D߿8$߼0߳('`߿8$߼0߳('`'9F0 % Q8!' H0X<P$!`8!!@$ $ <g$6Ri%$S3$&6%`%!%'gC!B3b! %&s%*c %`&!1@ @!#$&!1$hߣh`s\8&8!#8+h!č&!İ! %ȀE@<$`JW* %!$@(C`0%&1@ &_@&_A߼P߰0߲߱X߳Hߴߵ ߿8߶@%߷߾'pT$C$$@!!%C1b%#g##a!cs> %!@#|' %+$cÀ &!188!&!1,A)!$ _PP $&!9i!co %&aL\$`#@ %(% %(%% $$ $@\%\3* !\'!T'9N S$@%(A$  $,|'9@@ P$pa$$ $$!a$%%+%%`"%&1!'`%&s& %b@+* ư!i!cj&1%1߼P߰0߲߱X߳Hߴߵ ߿8߶@$߷߾'pߤ`  @%  %$$ $@$(}%T'9N S$@%(A$  $scT|'9@@ P$X߼P߰0߲߱X߳Hߴߵ ߿8߶@$߷߾'p$$!m$($ci($e%a $!] @8HV4@H8N4$d $H@988#@8`48!8#:,H@814$d $H@ 8##4#!#, , , , 0<D0<0񯈖<D0ꯃ<0寁<$D0௘<D0ٯ0%Xb48%H%g9!P%  %2t &|%fyb$*T@Ɏb(X|g9'$"( !BC1&#0",h|!!dE dԈ@% D$D @ "`$|||dd dԐȎ$` E$`  %B"dt %"$*T@Ȏ"(%'"*@#@ %C! E@ % D@ %e T@&"$t % %%#|'fC!($*`IdԠ +d  %|'fC!(8%I d %t ' ߿H߼@ߵ8ߴ0߳(߲ ߱߰'P'0( <%$!D%9-d @%%@ % (% P@% (% @@ %d (% @% %%߿0߼(߲ ߱߰'@'<8%$!C0%9-'| d菙' T@B %߿߼' '80( <$!Ch9-܏ @% J%$ @%  %$K|||dd dx'|'& &  d' @ % @ $R|||dd d' '  @ % @ $W|||dd d %߿8߼0߱(߰ '@'0( <$!A9-B@ @%@ % @@ %x'|'' d0 % ߿0߼(߰ '@' <%$!AL 9-  % ߿ ߼߰'0'@80( <$!@9-B@%'  %@(% '| 0% % d %| dX"@%'|@0% d@' @ @ %x'||dH dy菂|dBy%߿@߼8߲0߱(߰ 'P'PH@80<%$!?'9-(%|$ dBPB B@@ %'   %@(% ' | 0% % d %| dX"@@ %܏ @ @ %x'|'  dX %߿P߼H߲@߱8߰0'`'<$!>9-| d@@(%ȏ d| d@ @0%||dd d  |dc(dbbbb߿߼dB' '<$$!=9-߼' '<$!=9-d!%d!$d!$߼' '<$!=9-Ldd @%` $bd!"dBBb#$߿߼' '( <$0$!=%9-% %`(%f0%   %$d 0% %߿(߼ ߱߰'0'`XPH@80( <%$!<%9-$` %$(%f  $%` % @% %"!` %C &%0% $" $$ ` % R` %P` %$ , %$d`0%" l %$  V#'(% 0%!'&(%D A'# %C!C5!D(% @># %C!CՈ!D'(% @'` %'D(% @%߿`,c߾X߼P#߷HdB߶@ߵ8b$ߴ0߳(߲ ߱߰'p'ph`XPH@80( <%$!:d%9-$` %$(%g  $` % @%3%#` %! CfR%C&1` % @%$ b$b2!` % $C-` %l %$  ^#'(%  0%'(%!@D @'d!J %D(% A ` %$ d!J"q%d!J l$ &0% $ ` %$ $ @%r` %q$  %$d`0% @3` %$ l@%$  % ^#'(%  0%=!'&"(%@D A '#%C!d!JC2!D(% @#%C!Cd!J"!#%C!C!D'(% @'` %'D(% @%d!J"$߿p߾h߼`߷X߶PߵHߴ@߳8߲0߱(߰ ''0( <%$!6%9-$B@(%<  %$BA(%  %$BD % @ %߿0߼(߲ ߱߰'@'0( <%$!6 %9- %X(%g9ߜ @;% @% 4 %0% dJ $d0% d % (%  % 0%dJ $C %t@(%  %  %(%  % ( % dB%߿0߼(߲ ߱߰'@'0( <%$!4%9- %X(%g9ߜ @6% @% / %0% dJ $C& % (%  % 0%dJ $C %t@(%  %  %(%  % ( % @%%߿0߼(߲ ߱߰'@'<$!39-|dB}hB@B@$Xg9 |d!}l"@$|d!}h"|d!}l"|߿߼dB}lB' '0( <$$!29-fRQ(R!&1 *"@B@$Xg9 ߿0߼(߲ ߱߰'@'PH@80( <$!2L9-| dh@%'@(% $| dx@ '@0%||d d $|$dcbbb b(' fQ(fsP(!| %'G dఏ %| d!@` %| 0% dȏ` %B@% $&R*B@%߿P߼H߶@ߵ8ߴ0߳(߲ ߱߰'`'`XPH@80( <%$!0%9-$%$(%ȏ dK@ %$ $_ @ % $_d!J  dK@%(%d!L Xg9dK @%  %D dK@$d!L"%$(% dK@% %D dK@%:*b,c8Bb$``(%Xg9dK @ d!L"Xg9dK $- dK@%d!LL3&s`I'fKԀ!l %$_ l@%$- % @%++C$@0+@#R #|fR4#|fR y6#'(!0% Ѐ! %(% @%(% dJ' dJ@(% dJ&6&s`Ԁ!'dK (!@ %(% @%(% dJ' dJDdJ dK@3(% dJ@%)dBJdBLB@%d!L# $dcLcb(%X %g9 d!L"Xg9dK @%  %D dK@%%`%߿`߾X߼P߷H߶@ߵ8ߴ0߳(߲ ߱߰'p'H@80( <%$!,%9-|dL  d菙'| d菕|fl %X`(%g9 @f$bb$b0X %|g98d @ %$f '(%P0# |fX|g98d @B% % ,B@ %9(% 3 %@'(% |dc|C!t|dc|C!R@%'f1L X(!g9  %@(% D %' @ %`(% @ %&*@'%߿H߼@ߵ8ߴ0߳(߲ ߱߰'P'0( <%$!)%9- % @%@ % +@ %l(% @% % D # (% ,B%߿0߼(߲ ߱߰'@'0( <%$!) %9-@(%ȏ dM |XdB|0g98B!dM  %@(%l dM @%$ #|dB|B!dM  E߿0߼(߲ ߱dBM ߰'@'PH@80( <%$!(,%9-*@'$|@ %fl$_ %$RV!U!@ %e T@ &1B!C8b_,c,BC%@ `%&1*"@&s*@@ %%߿P߼H߶@ߵ8ߴ0߳(߲ ߱߰'`'<$!'9-dcQ(C!B@g%dcQ(C! E@@(%ȏ dN l$  dN d!O$"d!O$ dcO$c`A$ bD>$bd!O "bD dBO d!O B$C#BDdBO d!O$B"D8 ++b$`$ $ dcO$d!O$c$b"d8 ++b$`dcO$dBO cBb`dBO B%d!O d!O$ ߿߼' 'XPH@80( <%$!%@$_9-l @%$_ % @%%&$ @%'# %&(% 0%0! %(% #'(% 0%'! @%`%'!cBC!B0B@@&*@!|'X$dB|g9W|dB| S@% % %D' @ 0%8%|dO( d$ dO(@S 0%'|dO( d$ dO(@C`2%'X(!g9 @% %'D (% @ 0%8%|fRO(@ % d@ %$ @#@ % 0%|' d@ %$ @&*@''8%|dO( dD % dO(@dBO(''|dO( dD % dO(@%`dBO(%߿X߼P߷H߶@ߵ8ߴ0߳(߲ ߱߰'`'<8%$!!$9-0b@ 0f$$0b0c`0%%߼' '<0%$!!@8%9-$0b8%0b@$, @0b@@$8%%߼' '<h%$! ԍ9- /X%fP%) C!LcC!dE#@!@8b!!d%J$$D %cC!dE#\@bc!C! ٬LbC!b߼' '0( <%$!Q9-%&Pd X(%@ %g9 d BC C!Q(%d L0x%% @$bN+@( x%$m+ X@ Pl8!b#@ L!d#X@l@!h H%l@!L8!C#@ @$I @$bN+@$mU%-@9@ %$Lx!%%.+@)H% @$M X+` Pl8!b#@ L!d#X@l@!h H%l@!L8!C#@ @$I @$BN+@ @-@%@ %Xg9, D B߿0߼(߲ ߱߰'@'<$!|9-@ (%P@+(!!C`$D%߼' '<@%$! 9-@P@P@$cD!Hi+T@`H% b!B+T`@P%!C`$H߼' 'XPH@80<%$!x" 9-@@%%@'X&g9 `b! X$g9 @%'3 %  % B$@@ $ $%@'X'' '$g9 &T@ 'X@(%$' '$g9 'X`(%g9 $" #$߿X߼P߳H߲@߱8߰0'`'( <%$!9-fQ@+%@"+X %g9 "+T@"+P@`%@% !0Bd!ce%+P@b 8%!"+@$+@!%߿(߼ ߱߰'0'@80( %<C%$!9-C#|$B "@ %dHD |fP@ (%D$ @$z"Cd/%$ D(%$ !@&P&P" X %&%g9` X@ %&% g9 @%$"$zb &X %'g9` C!%߿@߼8߲0߱(߰ 'P'@80( %<#%$!%9-0b@@ &10c?b !/0b@0b? %'30b@,b/0c?C!@H @|dcXC!D"&1"#&1"#8b%0c !&1#&1#C!X %'g9` @ %'Xg9`  $@% C!D !gH(㯥X %'g9` @%C!ؠ`HX %'g9` X@ %'g9` $ C!D !eH@%X' %(%g9` X@ %'g9` @%CDDX' %(%g9` @%CDX %'g9` @%C$ @(%E% %0B@@%&Bhf$c hghhhilflglhlib$  &Bf$c ghib$ hbhfhglblflgh^ED@(%%0B@0%$h$ hhhllll$  $$ $ hhhlll $ %$&G$&EH$!H$d$c!0%C, @ %X %'g9` @%C d  %߿@߼8߲0߱(߰ 'P'<$!T9-dBQ@B d!Q@%߼' ' <%$!$9-  %@(% ߿ ߼߰'0'<$!9-dBQ@B d!Q@%߼' ' <%$!\$9-  %@(% ߿ ߼߰'0' <$!9-dcQ@b@pD b` %  %@&d ߿ ߼߰'0'<$!t9- @ % ߿߼' '<%$!0%9-Xg9 @%@ @ %X'g9 @%'(y%%$(% "'n,B$BB#CC!$Q+` &V %X(%'8%g9p @%+@ %$zC %X %'g9` C!BDB!d+$Q8c+C$@ %X(%''g9p @%+c+8cC$@ % %2@%h$ hhhllllbefgbefg$c  ܈$ ܂܅܆hbef$c h%hhlllgheghe߿߼߷߶ߵߴ߲߳߱߰' '@80%X%<n`%$!$9-@$B#x%4H%$8% P)%8dd!D!fEC#A@%$@h%(!g$F!!Gb(!g dd!!fEC#@@% %!H%.+@ϬgH%8%d D!C`D!$C%).+T@d%g߾@߼8߰0'P' <%$! %9-@%|t(%@0%f@`8%  %( % d '( <$! 9-D |$fHC $`%& TQ߿(߼ ߱߰'0$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.78 $$Revision: 1.4 $$Revision: 1.41 $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $$Revision: 1.19 $usage: findvalidsearches searchword partofspeechnum%uusage: bit bitnumusage: search searchword partofspeechnum searchtypenum sensenumusage: glosses [1 | 0]usage: fileinfo [1 | 0]usage: byteoffset [1 | 0]usage: senseflag [1 | 0]usage: contextualhelp partofspeechnum searchtypenumusage: reopendbusage: abortsearch%s&0findvalidsearchesbitsearchglossesfileinfobyteoffsetsenseflagcontextualhelpreopendbabortsearch$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $$Revision: 1.41 $$Revision: 1.19 $$Revision: 1.9 $Tktcl_rcFileName~/.wishrcbindtagsclipboardselectiontk_chooseColortk_getOpenFiletk_getSaveFiletk_messageBoxcheckbuttonmenubuttonradiobuttonscrollbartoplevel-colormapColormap for main window-displayDisplay to use-geometryInitial geometry for windowName to use for applicationUse synchronous mode for display serverVisual for main windowId of window in which to embed applicationPass all remaining arguments through to scriptdisabledno display name and no $DISPLAY environment variablecouldn't connect to display "bad screen number "%d"window name starts with an upper-case letter: "window name "" already exists in parenttk_strictMotifTkCreateMainWindow: builtin command with NULL string and object procstk_patchLeveltk_versioncan't create window: parent has been destroyedcan't create window: its parent has -container = yesbad window path name "Can't set sibling or stack mode from Tk_ConfigureWindow.UnlinkWindow couldn't find child in parentthis isn't a Tk applicationqueryInputStyle (processing arguments in argv variable)toplevel-colormapgeometrywm geometry . auto_loadcannot execute command "auto_load"cannot auto-load command "tkColorDialogtkMotifFDialogtkFDialogtkMessageBoxwrong # args: should be " cmd arg ?arg ...?" add pattern value ?priority?" get window name class"readfile readfile fileName ?priority?"bad option "": must be add, clear, get, or readfilewidgetDefaultstartupFileuserDefaultinteractivebad priority level "": must be widgetDefault, startupFile, userDefault, interactive, or a number between 0 and 100missing colon on line %dmissing value on line %dmissing newline on line %dcan't read options from a file in a safe interpretercouldn't open "error seeking to end of file "error reading file "~/.Xdefaultsunderlineoverstrikedemiboldsemicondensedcondensed-underline-overstrikeconfigurefamilies-descent-linespaceTkFontPkgFree: all fonts should have been freed alreadyoption ?arg?(hfont ?-displayof window? ?option?fontname ?options?named font "" doesn't existfontname ?fontname ...??-displayof window?font ?-displayof window? text-ascent %d -descent %d -linespace %d -fixed %d" already existsHelveticaTimes New RomanNew YorkCourier NewAvantGardeZapfChanceryZapfDingbatsNewCenturySchoolbookNewCenturySchlbkPalatinomissing value for "" optionunknown font style "-subsample-palettewrong # args: should be " option ?arg arg ...?" cget option"configure copy source-image ?-from x1 y1 x2 y2? ?-to x1 y1 x2 y2? ?-zoom x y? ?-subsample x y?" doesn't exist or is not a photo imagecoordinates for -from option extend outside source image get x y"coordinates out of range%d %d %d put {{colors...}...} ?-to x1 y1 x2 y2?"all elements of color list must have the same number of elementscan't parse color " read fileName ?-format format-name? ?-from x1 y1 x2 y2? ?-to x y? ?-shrink?"can't get image from a file in a safe interpreter-translationredither redither"can't write image to a file in a write fileName ?-format format-name??-from x1 y1 x2 y2?"outside imageno available image file format has file writing capabilityimage file format "" is unknown" has no file writing capabilitybad option "": must be blank, cget, configure, copy, get, put, read, redither, or writeunrecognized option "": must be " option requires one integer valuesvalue(s) for the -from option must be non-negativevalue(s) for the -tovalue(s) for the -zoom option must be positivethe "-format" option requires a valueImgPhotoGet couldn't find visual for window%d/%d/%dtried to delete photo image when instances still existDisposeColorTable couldn't find hash entry-file option isn't supported for " is not supportedcouldn't recognize data in image file "-data option isn't supported for image format "couldn't recognize image dataTimes New RomanNew YorkCourier NewHelvetica-*-%.240s-*-*-*-*-*-*-*-*-*-*-*-*TkpGetFontFromAttributes: cannot get any font%.240s-*-%d-*-*-*-*-*%svalue for "" missing (processing "%.40s" option) (%s "%.50s" in widget "%.50s")database entry fordefault value forambiguous option "unknown option "couldn't find synonym for option "b$bpccXbccccdd8ddde b$eXeef0fxfbad config table: unknown type %dm`mpmmmmmnn$nDndn|n|nnm`nnno o@oT?? unknown type ??qpqpq8qTpqpqpbogus "which" value in Tk_3DBorderGCbad relief type "%.50s": must be %sflat, groove, raised, ridge, solid, or sunkenunknown reliefCheckbuttonRadiobutton-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-command-defaultdisabled-disabledforegrounddisabledForegroundDisabledForeground-disabledforegrounddisabledForegroundDisabledForegroundforegroundHelvetica -12 bold-foregroundforegroundForeground-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-highlightthicknesshighlightThicknessHighlightThickness-indicatoronindicatorOnIndicatorOn-justify-offvalueoffValue-onvalue-selectcolorselectColorBackground-selectcolorselectColorBackground-selectimageselectImageSelectImage-takefocustakeFocusTakeFocus-takefocustakeFocusTakeFocus-textvariabletextVariableVariable-underlineunderlineUnderline-variablevariableVariableselectedButton-variablevariableVariable-wraplengthwrapLengthWrapLengthcget or configurecget, configure, flash, or invokecget, configure, deselect, flash, invoke, select, or togglecget, configure, deselect, flash, invoke, or selectwrong # args: should be " pathName ?options?"wrong # args: should be "%.50s option ?arg arg ...?" cget option"configuredeselectwrong # args: should be "%.50s deselect"wrong # args: should be "%.50s flash"wrong # args: should be "%.50s invoke"wrong # args: should be "%.50s select"wrong # args: should be "%.50s toggle"bad option "%.50s": must be %sbad state value "": must be normal, active, or disabledbad -default value " (processing -width option) (processing -height option)wrong # args: should be " option ?args?" create type ?name? ?options?"image type "" doesn't exist height name" type name" width name"bad option "": must be create, delete, height, names, type, types, or widthbad anchor position "": must be n, ne, e, se, s, sw, w, nw, or center$,4<DLT\unknown anchor positionbad join style "": must be bevel, miter, or roundunknown join styleprojectingbad cap style "": must be butt, projecting, or roundunknown cap stylebad justification "": must be left, right, or centerunknown justification stylebad screen distance "KeyPressKeyReleaseButtonPressButtonReleaseFocusOutVisibilityReparentConfigureCirculatePropertyColormapActivateDeactivateNotifyNormalNotifyGrabNotifyUngrabNotifyWhileGrabbedNotifyAncestorNotifyVirtualNotifyInferiorNotifyNonlinearNotifyNonlinearVirtualNotifyPointerNotifyPointerRootNotifyDetailNonePlaceOnTopPlaceOnBottomVisibilityUnobscuredVisibilityPartiallyObscuredVisibilityFullyObscuredTk_DeleteBinding couldn't find object table entryTk_DeleteBinding couldn't find on object listTk_DeleteBinding couldn't find on hash chainTk_DeleteAllBindings couldn't find on hash chainTk_BindEvent: missing command (command bound to event)MatchPattern: badly constructed virtual eventX$0T8D\h,DtkScreenChanged (changing screen in event binding)wrong # args: should be " option ?arg1?" add virtual sequence ?sequence ...?" delete virtual ?sequence sequence ...?"generate generate window event ?options?" info ?virtual?"bad option "": should be add, delete, generate, infoDeleteVirtualEvent: couldn't find ownerTk_DeleteVirtualEvent couldn't find on hash chainbad window name/identifier "window id "" doesn't exist in this applicationDouble or Triple modifier not allowedonly one event specification allowedvalue for "" missingbad position "": should be now, head, mark, tail-borderwidth-keycodeunknown keysym "no keycode for keysym "-override-sendevent-subwindowbad option to event: "virtual event "" is badly formedvirtual event not allowed in definition of another virtual eventno events specified in bindingvirtual events may not be composedbad ASCII character 0x%xvirtual event "<<>>" is badly formedmissing ">" in virtual bindingspecified button "" for non-button eventbad event type or keysym "specified keysym "" for non-key eventno event type or button # or keysymextra characters after detail in bindingmissing ">" in bindingTkpGetShadows couldn't allocate bitmap for borderinvalid color name "unknown color name "#%04x%04x%04xTk_GCForColor called with bogus colorTk_FreeColor called with bogus colorFindClosestColor couldn't lookup visualFindClosestColor ran out of colorscan't specify bitmap with '@' in a safe interpretererror reading bitmap file "bitmap "" not definednative bitmap creation failedbitmap already registered in Tk_GetBitmap" is already definedTk_NameOfBitmap received unknown bitmap argumentTk_SizeOfBitmap received unknown bitmap argumentTk_FreeBitmap called before Tk_GetBitmapTk_FreeBitmap received unknown bitmap argumenthourglassquestheadquestionThe name registry was modified without being locked!-displayofbad option "": must be -async, -displayof, or --wrong # args: should be " ?options? interpName arg ?arg ...?"errorInfoerrorCodeno application named "target application died or uses a Tk version before 4.0target application diedTk_SendCmd: corrupted send stackTk_CreateWindow failed in SendInit!InterpRegistryTK_APPLICATIONX server insecure (must use xauth-style authorization); command ignoredreceiver never heard of interpreter "no application named "%s"SECONDARYCARDINALCOLORMAPCUT_BUFFER0CUT_BUFFER1CUT_BUFFER2CUT_BUFFER3CUT_BUFFER4CUT_BUFFER5CUT_BUFFER6CUT_BUFFER7DRAWABLERECTANGLERESOURCE_MANAGERRGB_COLOR_MAPRGB_BEST_MAPRGB_BLUE_MAPRGB_DEFAULT_MAPRGB_GRAY_MAPRGB_GREEN_MAPRGB_RED_MAPVISUALIDWM_COMMANDWM_HINTSWM_CLIENT_MACHINEWM_ICON_NAMEWM_ICON_SIZEWM_NORMAL_HINTSWM_SIZE_HINTSWM_ZOOM_HINTSMIN_SPACENORM_SPACEMAX_SPACEEND_SPACESUPERSCRIPT_XSUPERSCRIPT_YSUBSCRIPT_XSUBSCRIPT_YUNDERLINE_POSITIONUNDERLINE_THICKNESSSTRIKEOUT_ASCENTSTRIKEOUT_DESCENTITALIC_ANGLEX_HEIGHTQUAD_WIDTHPOINT_SIZERESOLUTIONCOPYRIGHTFONT_NAMEFAMILY_NAMEFULL_NAMECAP_HEIGHTWM_CLASSWM_TRANSIENT_FOR?bad atom?$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $$Revision: 1.41 $$Revision: 1.29 $$Revision: 1.4 $$Revision: 1.24 $$Revision: 3.73 $$Revision: 7.41 $$Revision: 1.35 $$Revision: 1.78 $$Revision: 3.71 $$Revision: 3.62 $$Revision: 1.5 $$Revision: 3.53 $$Revision: 1.51 $$Id: ptimers.h,v 1.4 1997/01/15 04:44:41 jwag Exp $$Revision: 1.137 $@(#)uts-3b2:io/uio.h 1.2$Revision: 1.22 $$Revision: 1.9 $$Revision: 1.1 $tk_libraryargv0tk: inputStyleclientWindowfocusWindowWM_PROTOCOLSTk_QueueWindowEvent found unexpected delayed motion eventDelayedMotionProc found no delayed mouse motion eventwrong # args: should be " ?-global? window" or " option ?arg arg ...?" current ?window?" release window" set ?-global? window"bad argument "": must be " status window"unknown or ambiguous option "": must be current, release, set, or statusgrab failed: another application has grabgrab failed: window not viewablegrab failed: keyboard or pointer frozengrab failed: invalid timegrab failed for unknown reason (code %d)couldn't unlink window in TkWmDeadWindowwrong # args: should be " option window ?arg ...?"wrong # arguments: must be " tracing ?boolean?"window "" isn't a top-level window aspect window ?minNumer minDenom maxNumer maxDenom?"%d %d %d %daspect number can't be <= 0 client window ?name?"WM_CLIENT_MACHINEcolormapwindows colormapwindows window ?windowList?" command window ?value?"WM_COMMANDdeiconify deiconify window"can't deiconify : it is an icon for focusmodel focusmodel window ?active|passive?"bad argument "": must be active or passive frame window"geometry geometry window ?newGeometry?"%dx%d%c%d%c%d grid window ?baseWidth baseHeight widthInc heightInc?"baseWidth can't be < 0baseHeight can't be < 0widthInc can't be < 0heightInc can't be < 0 group window ?pathName?"iconbitmap iconbitmap window ?bitmap?" iconify window"can't iconify "": override-redirect flag is set": it is a transientcan't iconify couldn't send iconify message to window managericonmask iconmask window ?bitmap?"iconname iconname window ?newName?"iconposition iconposition window ?x y?"iconwindow iconwindow window ?pathName?"can't use as icon window: not at top level is already an icon for couldn't send withdraw message to window manager maxsize window ?width height?" minsize window ?width height?"overrideredirect overrideredirect window ?boolean?"positionfrom positionfrom window ?user/program?"": must be program or userprotocol protocol window ?name? ?command?"resizable resizable window ?width height?"sizefrom sizefrom window ?user|program?" state window"withdrawn title window ?newTitle?"transient transient window ?master?"withdraw withdraw window"can't withdraw unknown or ambiguous option "": must be aspect, client, command, deiconify, focusmodel, frame, geometry, grid, group, iconbitmap, iconify, iconmask, iconname, iconposition, iconwindow, maxsize, minsize, overrideredirect, positionfrom, protocol, resizable, sizefrom, state, title, transient, or withdrawTopLevelEventProc: user changed %s size to %dx%d ConfigureEvent: %s x = %d y = %d, width = %d, height = %d send_event = %d, serial = %ld __WM_ROOT__SWM_ROOT%s format %d numItems %ld ReparentEvent got bogus VROOT property:ReparentEvent: %s reparented to 0x%x, vRoot = 0x%x wrapperPtr coords %d,%d, wmPtr coords %d,%d, offsets %d %d TopLevelEventProc: %s deleted UpdateGeometryInfo moving to %d %d, resizing to %d x %d, UpdateGeometryInfo resizing to %d x %d WaitForConfigureNotify giving up on %s WaitForConfigureNotify finished with %s, serial %ld WaitForMapNotify giving up on %s WaitForMapNotify finished with %s bad geometry specifier "Tk_CoordsToWindow got False return from XTranslateCoordinatesUpdateVRootGeometry: x = %d, y = %d, width = %d, height = %d, status = %d Tk_MoveToplevelWindow called with non-toplevel windowWM_DELETE_WINDOWWM_PROTOCOLS (command for "" window manager protocol)TkUnixSetMenubar got bad menubarGC already registered in Tk_GetGCTk_FreeGC called before Tk_GetGCTk_FreeGC received unknown gc argumentpseudocolorgrayscaledirectcolortruecolorstaticcolorstaticgraychildrencolormapfullgeometryismappedpointerxpointerypointerxyreqheightreqwidthscreencellsscreendepthscreenheightscreenwidthscreenmmheightscreenmmwidthscreenvisualtoplevelviewablevisualidvrootheightvrootwidthatomnamecontainingpathnamevisualsavailablewrong # args: should be " ?-displayof window?"-displayofbad option "": must be -displayof window ?pattern? ?command?" window ?tags?" window ?belowThis?"can't lower "" below " window ?aboveThis?"can't raise "" above "option ?arg??newName??-displayof window? ?factor? variable|visibility|window name"variablevisibilitywindow "" was deleted before its visibility changed": must be variable, visibility, or windowidletasks": must be idletasks ?idletasks?"OOP@P|PPQ\QQR,RxRSSSST$T\TTUPUUVPVVWLWxWWNXPXXYLYYZ$Z\Z[[t[\T\] ]T]]%dx%d+%d+%d?-displayof window? name?-displayof window? id?bad atom?no atom exists with id "?-displayof window? rootX rootY?-displayof window?window id "" doesn't exist in this applicationwindow numberwindow colorName%d %d %dincludeidswindow ?includeids?can't find any visuals for screenvalue for "-displayof" missingcan't invoke "" command: application has been destroyedwrong # args: should be " option arg ?arg ...?"wrong number of arguments: must be " bbox master ?column row ?column row??"%d %d %d %dconfigurebad argument "": must be name of window info window" -column %d -row %d -columnspan %d -rowspan %d -ipadx %d -ipady %d -padx %d -pady %d -sticky location location master x y"propagate propagate window ?boolean?" size window" slaves window ?-option value...?"invalid args: should be " is an invalid value: should NOT be < 0 is an invalid option: should be "-row, -column"columnconfigurerowconfigure master index ?-option value...?" must be a single element." is out of range-minsize %d -pad %d -weight %dinvalid arg "" :expecting -minsize, -pad, or -weight.-minsize": should be non-negative": expecting -minsize, -pad, or -weight.bad option "": must be bbox, columnconfigure, configure, forget, info, location, propagate, remove, rowconfigure, size, or slaves.Unlink couldn't find previous windowunexpected parameter, "", in configure list. Should be window name or optionMust specify window before shortcut '-'.invalid window shortcut, "" should be '-', 'x', or '^'extra option or option with no valuecan't manage "": it's a top-level windowunknown or ambiguous option "": must be -column, -columnspan, -in, -ipadx, -ipady, -padx, -pady, -row, -rowspan, or -stickybad column value "": must be a non-negative integer-columnspanbad columnspan value "": must be a positive integerWindow can't be managed in itselfbad ipadx value "": must be positive screen distancebad ipady value "bad padx value "bad pady value "bad grid value "-rowspanbad rowspan value "bad stickyness value "": must be a string containing n, e, s, and/or wcan't put inside , would cause management loop.can't use '^', cant find mastercan't find slave to extend with "^".can't determine master windowӜӜӜӜӜӘӘdirectcolorgrayscalegreyscalepseudocolorstaticcolorstaticgraystaticgreytruecolorbad X identifier for visual: unknown or ambiguous visual name "": class must be or defaultcouldn't find an appropriate visualcan't use colormap for : not on same screen: incompatible visualsunknown display passed to Tk_FreeColormapunknown display passed to Tk_PreserveColormap-displayofwrong # args: should be " -displayof window" -force window"-lastfor -lastfor window"bad option "": must be -displayof, -force, or -lastforFocussed implicitly on %s Defocussed implicit Async releasing focus to root after %s died forwarding focus to %s after %s died auto-focussing on %s, force %d TkUseWindow: X window already assignedcouldn't create child of window "TkMakeWindow couldn't find container for windowContainerEventProc couldn't find Container recordTkpGetOtherWindow couldn't find windowTkUnixContainerId couldn't find windowChangeXFocus got null X windowwrong # args: should be " option arg ?arg ...?"window "" isn't packed"pack before" couldn't find predecessorconfigurebad argument "": must be name of window info window" -expand -ipadx %d -ipady %d -padx %d -pady %dpropagate propagate window ?boolean?" slaves window" unpack window"bad option "": must be configure, forget, info, propagate, or slavesh0dbad frame factor in ArrangePackingwrong # args: window "" should be followed by optionscan't pack inside wrong # args: "" option must be followed by screen distancebad pad value "": must be positive screen distancewrong # args: "frame" option must be followed by anchor point": should be top, bottom, left, right, expand, fill, fillx, filly, padx, pady, or frameUnlink couldn't find previous windowcan't pack "": it's a top-level windowextra option "" (option with no value?)bad fill style "": must be none, x, y, or bothbad side "": must be top, bottom, left, or rightunknown or ambiguous option "": must be -after, -anchor, -before, -expand, -fill, -in, -ipadx, -ipady, -padx, -pady, or -side inside itself-activebackground-activeforeground-accelerator-background-columnbreak-command-foreground-hidemargin-indicatoron-offvalue-onvalue-selectcolor-selectimage-variable-variableselectedButton-underline-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activeborderwidthactiveBorderWidthBorderWidth-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-disabledforegrounddisabledForegroundDisabledForeground-disabledforegrounddisabledForegroundDisabledForegroundforegroundHelvetica -12 bold-foregroundforegroundForeground-postcommandpostCommand-selectcolorselectColorBackground-selectcolorselectColorBackground-takefocustakeFocusTakeFocus-tearoff-tearoffcommandtearOffCommandTearOffCommandwrong # args: should be " pathName ?options?" option ?arg arg ...?"activate activate index" add type ?options?" cget option" clone newMenuName ?menuType?"configure delete first ?last?"entrycget entrycget index option"entryconfigure entryconfigure index ?option value ...?" index string" insert index type ?options?" invoke index" post x y"postcascade postcascade index" type index"separatorcheckbuttonradiobutton unpost"yposition yposition index"bad option "": must be activate, add, cget, clone, configure, delete, entrycget, entryconfigure, index, insert, invoke, post, postcascade, type, unpost, or ypositiontkTearOffMenuAttempting to delete master menu when there are still clones.bad menu entry index "bad index "bad menu entry type "": must be cascade, checkbutton, command, radiobutton, or separatorCloneMenu failed inside of MenuAddOrInsert.bad menu type - must be normal, tearoff, or menubartkMenuDupbindtagsbad state value "": must be normal, active, or disabled-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-exportselectionexportSelectionExportSelectionforegroundCourier -12-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-insertbackgroundinsertBackgroundForeground-insertborderwidthinsertBorderWidthBorderWidth-insertborderwidthinsertBorderWidthBorderWidth-insertofftimeinsertOffTime-insertontimeinsertOnTime-insertwidthinsertWidthInsertWidth-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-setgrid-spacing1spacing1-spacing2spacing2-spacing3spacing3-takefocustakeFocusTakeFocus-xscrollcommandxScrollCommandScrollCommand-yscrollcommandyScrollCommandScrollCommandwrong # args: should be " pathName ?options?"disabled option ?arg arg ...?" bbox index"%d %d %d %d cget option" compare index1 op index2"bad comparison operator "": must be <, <=, ==, >=, >, or !=configure debug boolean" delete index1 ?index2?"dlineinfo dlineinfo index"%d %d %d %d %d get index1 ?index2?" index index" insert index chars ?tagList chars tagList ...?"bad option "": must be bbox, cget, compare, configure, debug, delete, dlineinfo, get, image, index, insert, mark, scan, search, see, tag, window, xview, or yviewbad state value "": must be normal or disabledbad wrap mode "": must be char, none, or word (while processing -tabs option)TextFetchSelection couldn't find end of rangebad switch "": must be -forward, -backward, -exact, -regexp, -nocase, -count, or ---backwardsno value given for "-count" option-forwards search ?switches? pattern index ?stopIndex?bad tab alignment "": must be left, right, center, or numeric-command dump ?-all -image -text -mark -tag -window? ?-command script? index ?index2?LayoutDLine couldn't place any characters on a linetk_textRelayoutAdded too many new lines in UpdateDisplayInfotk_textRedrawwrong # args: should be " see index"-pickplace yview -pickplace lineNum|index" scan mark|dragto x y"bad scan option "": must be mark or dragto (horizontal scrolling command executed by text) (vertical scrolling command executed by text)FindDLine reached end of textcharactertoggleOntoggleOffSplitSeg reached end of line!TkBTreeFindLine ran out of nodesTkBTreeFindLine ran out of linesTkBTreePreviousLine ran out of linesTkBTreeLineIndex couldn't find lineTkBTreeLineIndex couldn't find nodeChangeNodeToggleCount: bad toggle count (%d) max (%d)TkBTreeNextTag found incorrect tag summary info.TkBTreePrevTag found incorrect tag summary info.TkBTreeCheck found "%s" with toggles (%d) but no rootTkBTreeCheck found root for "%s" with no togglesTkBTreeCheck found odd toggle count for "%s" (%d)TkBTreeCheck found root node with summary infoTkBTreeCheck toggleCount (%d) wrong for "%s" should be (%d)TkBTreeCheck: less than 2 lines in treeTkBTreeCheck: last line has bogus segment typeTkBTreeCheck: last line has too many segmentsTkBTreeCheck: last line has wrong # characters: %dTkBTreeCheck: last line had bad value: %sCheckNodeConsistency: bad child count (%d)CheckNodeConsistency: line doesn't point to parentCheckNodeConsistency: line has no segmentsCheckNodeConsistency: wrong segment order for gravityCheckNodeConsistency: line ended with wrong typeCheckNodeConsistency: node doesn't point to parentCheckNodeConsistency: level mismatch (%d %d)CheckNodeConsistency: node tag "%s" not %spresent in parent summariesCheckNodeConsistency: mismatch in numChildren (%d %d)CheckNodeConsistency: mismatch in numLines (%d %d)CheckNodeConsistency: found unpruned root for "%s"CheckNodeConsistency: mismatch in toggleCount (%d %d)CheckNodeConsistency: duplicated node tag: %sCharCheckProc: segment has size <= 0CharCheckProc: segment has wrong sizeCharCheckProc: line doesn't end with newlineCharCheckProc: adjacent character segments weren't mergedToggleCheckProc: segment had non-zero sizeToggleCheckProc: toggle counts not updated in nodesToggleCheckProc: tag not present in nodeToggleCheckProc: tag present in root node summarywrong # args: should be " mark option ?arg arg ...?" mark gravity markName ?gravity?there is no mark named "bad mark gravity "": must be left or right mark names" mark next index"previous mark previous index" mark set markName index"bad mark option "": must be gravity, names, next, previous, set, or unsetMarkCheckProc: markPtr->body.mark.linePtr bogusMarkCheckProc couldn't find hash table entry for marktext doesn't contain any characters tagged with "bad text index "linestartwordstart-stretchwrong # args: should be " window option ?arg arg ...?" window cget index option"no embedded window at index "configure window configure index ?option value ...?" window create index ?option value ...?" window names"bad window option "": must be cget, configure, create, or namescan't embed baselinebad alignment "": must be baseline, bottom, center, or topNon-zero offset in EmbWinLayoutProc relative to EmbWinCheckProc: embedded window is last segment in lineEmbWinCheckProc: embedded window has size %dwrong # args: should be " image option ?arg arg ...?" image cget index option"no embedded image at index "configure image configure index ?option value ...?" image create index ?option value ...?" image names"bad image option "": must be cget, configure, create, or namesbaselinebad alignment "": must be baseline, bottom, center, or topNon-zero offset in EmbImageLayoutProcEmbImageCheckProc: embedded image is last segment in lineEmbImageCheckProc: embedded image has size %d-background-bgstipple-borderwidth-fgstipple-foreground-justify-lmargin1-lmargin2-overstrike-rmargin-spacing1-spacing2-spacing3-underlinewrong # args: should be " tag option ?arg arg ...?" tagName index1 ?index2 index1 index2 ...?" tag bind tagName ?sequence? ?command?"requested illegal events; only key, button, motion, enter, leave, and virtual events may be used tag cget tagName option"configure tag configure tagName ?option? ?value? ?option value ...?"bad wrap mode "": must be char, none, or word tag delete tagName tagName ..." tag lower tagName ?belowThis?" tag names ?index?"nextrange tag nextrange tagName index1 ?index2?"prevrange tag prevrange tagName index1 ?index2?" tag raise tagName ?aboveThis?" tag ranges tagName"bad tag option "": must be add, bind, cget, configure, delete, lower, names, nextrange, raise, ranges, or remove" isn't defined in text widgetcouldn't read raw PPM header from file "PPM image file "" has dimension(s) <= 0" has bad maximum intensity value not enough dataerror reading PPM image file "P6 %d %d 255 error writing "%d %d %dwrong # args: should be " moveto fraction" scroll number units|pages"bad argument "": must be units or pagesunknown option "": must be moveto or scrollTkFindStateNum: no choices in lookup table value "": must be format "" does not match current format "wrong # args: should be " option ?arg arg ...?"-displayofunknown option " append ?options? data"value for "" missing clear ?options?"bad option "%.50s": must be clear or appendselection handler returned too many bytes selection doesn't exist or form "" not definedwrong # args: should be "%.50s option ?arg arg ...?"value for "" missing-displayof-selectionunknown option "wrong # args: should be " clear ?options?" get ?options?" handle ?options? window command"-command own ?options? ?window?"bad option "%.50s": must be clear, get, handle, or ownMULTIPLETIMESTAMPCOMPOUND_TEXTTK_APPLICATIONTK_WINDOWCLIPBOARD%s %d %dMULTIPLE TARGETS TIMESTAMP TK_APPLICATION TK_WINDOWselection handler returned too many bytes selection doesn't exist or form "" not definedselection property too largebad format for string selection: wanted "8", got "%d"bad format for selection: wanted "32", got "%d"selection owner didn't respondcursor already registered in Tk_GetCursorinvalid color name "cursor already registered in Tk_GetCursorFromDatacursor id 0x%xTk_FreeCursor called before Tk_GetCursorTk_FreeCursor received unknown cursor argumentX_cursorbased_arrow_downbased_arrow_upbogositybottom_left_cornerbottom_right_cornerbottom_sidebottom_teebox_spiralcenter_ptrcoffee_mugcross_reversecrosshairdiamond_crossdouble_arrowdraft_largedraft_smalldraped_boxexchangeiron_crossleft_ptrleft_sideleft_teeleftbuttonll_anglelr_anglemiddlebuttonquestion_arrowright_ptrright_sideright_teerightbuttonrtl_logosailboatsb_down_arrowsb_h_double_arrowsb_left_arrowsb_right_arrowsb_up_arrowsb_v_double_arrowspraycantop_left_arrowtop_left_cornertop_right_cornertop_sideul_angleumbrellaur_angleinvalid color name "couldn't load cursor fontcan't get cursor from a file in a safe interpretercleanup reading bitmap file "bad hot spot in bitmap file "source and mask bitmaps have different sizesbad cursor spec "-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-closeenoughcloseEnoughCloseEnough-confine-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-insertbackgroundinsertBackgroundForeground-insertborderwidthinsertBorderWidthBorderWidth-insertborderwidthinsertBorderWidthBorderWidth-insertofftimeinsertOffTime-insertontimeinsertOnTime-insertwidthinsertWidthInsertWidth-scrollregionscrollRegionScrollRegion-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-takefocustakeFocusTakeFocus-xscrollcommandxScrollCommandScrollCommand-xscrollincrementxScrollIncrementScrollIncrement-yscrollcommandyScrollCommandScrollCommand-yscrollincrementyScrollIncrementScrollIncrementwrong # args: should be " pathName ?options?" option ?arg arg ...?" addtags tag searchCommand ?arg arg ...?" addtag tag bbox tagOrId ?tagOrId ...?"%d %d %d %d bind tagOrId ?sequence? ?command?"" doesn't existrequested illegal events; only key, button, motion, enter, leave, and virtual events may be used canvasx screenx ?gridspacing?" canvasy screeny ?gridspacing?" cget option"configure coords tagOrId ?x y x y ...?" create type ?arg arg ...?"unknown or ambiguous item type " dchars tagOrId first ?last?" dtag tagOrId ?tagToDelete?" find searchCommand ?arg arg ...?" focus ?tagOrId?" gettags tagOrId" icursor tagOrId index" index tagOrId string"can't find an indexable item " insert tagOrId beforeThis string"itemcget itemcget tagOrId option"itemconfigure itemconfigure tagOrId ?option value ...?" lower tagOrId ?belowThis?"" doesn't match any items move tagOrId xAmount yAmount"postscript raise tagOrId ?aboveThis?"tagOrId " scale tagOrId xOrigin yOrigin xScale yScale"scale factor cannot be zero scan mark|dragto x y"bad scan option "": must be mark or dragto select option ?tagOrId? ?arg?"can't find an indexable and selectable item " select adjust tagOrId index" select clear" select from tagOrId index" select item" select to tagOrId index"bad select option "": must be adjust, clear, from, item, or to type tag"bad option "": must be addtag, bbox, bind, canvasx, canvasy, cget, configure, coords, create, dchars, delete, dtag, find, focus, gettags, icursor, index, insert, itemcget, itemconfigure, lower, move, postscript, raise, scale, scan, select, type, xview, or yviewbad scrollRegion " above tagOrId below tagOrId closest x y ?halo? ?start?can't have negative halo value "enclosed enclosed x1 y1 x2 y2overlapping overlapping x1 y1 x2 y2 withtag tagOrIdbad search command "": must be above, all, below, closest, enclosed, overlapping, or withtag-outline-stipplerectanglewrong # args: should be " create x1 y1 x2 y2 ?options?"wrong # coordinates: expected 0 or 4, got %d%.15g %.15g moveto %.15g 0 rlineto 0 %.15g rlineto %.15g 0 rlineto closepath matrix currentmatrix %.15g %.15g translate %.15g %.15g scale 1 0 moveto 0 0 1 0 360 arc setmatrix grestore gsave %d setlinewidth 0 setlinejoin 2 setlinecap %.15g %.15g moveto %.15g %.15g %.15g %.15g %.15g %.15g curveto %.15g %.15g moveto %.15g %.15g %.15g %.15g %.15g %.15g curveto wrong # args: should be " create x y ?options?"wrong # coordinates: expected 0 or 2, got %dcan't use in a window item of this canvas((()() )(()<-arrowshape-capstyle-joinstyle-splinesteps-stipplewrong # args: should be " create x1 y1 x2 y2 ?x3 y3 ...? ?options?"too few coordinates for line: must have at least 4odd number of coordinates specified for linebad arrow spec "": must be none, first, last, or bothParseArrowShape received bogus offsetbad arrow shape "": must be list with three numbers%.5g %.5g %.5g%d setlinewidth 0 setlinecap 1 setlinecap 2 setlinecap 0 setlinejoin 1 setlinejoin 2 setlinejoin StrokeClip grestore gsave wrong # args: should be " create x y ?options?"wrong # coordinates: expected 0 or 2, got %dZZZZ[ZT[(ZX[@Helvetica 12 bold-justify-stipplewrong # args: should be " create x y ?options?"wrong # coordinates: expected 0 or 2, got %dm m mmmmmm mmDmmmmDmTmTmTmDsel.firstselection isn't in itemsel.lastbad index "/StippleText { } bind def %.15g %.15g [ }~~,<~L] %d %g %g %s %s DrawText -colormap-colormode-channel-fontmap-pageanchor-pageheight-pagewidth8TTT88``pp`pmonochromebad color mode "": must be monochrome, gray, or colorcan't specify both -file and -channelcan't specify -file in a safe interpreterchannel "" wasn't opened for writing%!PS-Adobe-3.0 EPSF-3.0 %%Creator: Tk Canvas Widget %%Title: Window %%CreationDate: %d %d %d %d%%BoundingBox: %%Pages: 1 %%DocumentData: Clean7Bit Landscape Portrait %%Orientation: %%DocumentNeededResources: font %%+ font %%EndComments /CL %d def %%BeginSetup %%IncludeResource: font %%EndSetup %%Page: 1 1 %.1f %.1f translate 90 rotate %.4g %.4g scale %d %d translate %d %.15g moveto %d %.15g lineto %d %.15g lineto %d %.15g lineto closepath clip newpath (generating Postscript for item %d)grestore restore showpage %%Trailer end %%EOF %.3f %.3f %.3f setrgbcolor AdjustColor bad font map entry for " findfont scalefont ISOEncode setfont StippleFill %.15g %.15g moveto %.15g %.15g lineto bad distance "tk_librarycouldn't find library directory: tk_library variable doesn't existprolog.pserror seeking to end of file "error reading file "-background-foregroundwrong # args: should be " create x y ?options?"wrong # coordinates: expected 0 or 2, got %d X,\D4Tt%.15g %.15g moveto %d 0 rlineto 0 %d rlineto %d %s 0 rlineto closepathcan't generate Postscript for bitmaps more than 60000 pixels wide%.15g %.15g translate 0 -%.15g translate %d %d true matrix { } imagemask -backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidthToplevel-colormapcolormapColormap-containercontainerContainer-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-takefocustakeFocusTakeFocuswrong # args: should be " pathName ?options?"-colormapTkCreateFrame didn't get application nameToplevelcolormapColormapA window cannot have both the -use and the -container option set. option ?arg arg ...?" cget option"configure-containercan't modify option after widget is createdbad option "": must be cget or configurewrong # args: should be " option|pathName argsconfigure configure pathName option value ?option value ...?" forget pathName" info pathName" -relx %.4g -rely %.4g -width %d -width {} -relwidth %.4g -relwidth {} -height %d -height {} -relheight %.4g -relheight {} -anchor -bordermode outside -bordermode ignore slaves pathName"unknown or ambiguous option "": must be configure, forget, info, or slavesUnlinkSlave couldn't find slave to unlinkcan't use placer on top-level window ""; use wm command insteadextra option "" (option with no value?)-bordermodebad border mode "": must be ignore, inside, or outsidecan't place relative to relative to itself-relheight-relwidth": must be -anchor, -bordermode, -height, -in, -relheight, -relwidth, -relx, -rely, -width, -x, or -yט׬״X`Print summary of command-line options and abortambiguous option "unrecognized argument "l| P|(Dtexpected integer argument " but got "expected floating-point argument for "" option requires two following argumentsbad argument type %d in Tk_ArgvInfo" option requires an additional argumentCommand-specific options: Default value: Default value: " Generic options for all commands:-outline-outlinestipple-stipplepieslicewrong # args: should be " create x1 y1 x2 y2 ?options?"pieslicewrong # coordinates: expected 0 or 4, got %dbad -style option "": must be arc, chord, or pieslicematrix currentmatrix %.15g %.15g translate %.15g %.15g scale 0 0 1 %.15g %.15g arc closepath setmatrix 0 0 moveto 0 0 1 %.15g %.15g arc closepath setmatrix grestore gsave 0 0 1 %.15g %.15g arc setmatrix %d setlinewidth 0 setlinecap StrokeClip -activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-backgroundbackgroundBackground-backgroundbackgroundBackground-bigincrementbigIncrementBigIncrementborderWidthbackground-borderwidthborderWidthBorderWidth-commandforegroundHelvetica -12 bold-foregroundforegroundForeground-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThicknessvertical-repeatdelayrepeatDelayRepeatDelay-repeatintervalrepeatIntervalRepeatInterval-resolutionresolutionResolution-showvalueshowValueShowValue-sliderlengthsliderLengthSliderLength-sliderreliefsliderReliefSliderRelief-takefocustakeFocusTakeFocus-tickintervaltickIntervalTickInterval-troughcolortroughColorBackground-troughcolortroughColorBackground-variablevariableVariablewrong # args: should be " pathName ?options?" option ?arg arg ...?" cget option"configure coords ?value?" get ?x y?"identify identify x y" set value"bad option "": must be cget, configure, coords, get, identify, or setverticalhorizontalbad orientation "": must be vertical or horizontalbad state value "": must be normal, active, or disabledcan't assign non-numeric value to scale variable (command executed by scale)-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activeforegroundactiveForegroundBackground-activeforegroundactiveForegroundBackground-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-directiondirectionDirection-disabledforegrounddisabledForegroundDisabledForeground-disabledforegrounddisabledForegroundDisabledForegroundforegroundHelvetica -12 bold-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-indicatoronindicatorOnIndicatorOn-justify-takefocustakeFocusTakeFocus-textvariabletextVariableVariable-underlineunderlineUnderline-wraplengthwrapLengthWrapLengthwrong # args: should be " pathName ?options?"Menubutton option ?arg arg ...?" cget option"configurebad option "": must be cget or configurebad state value "": must be normal, active, or disabledbad direction value "": must be above, below, left, right, or flush (processing -width option) (processing -height option)-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidthforegroundHelvetica -12 bold-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-justify-takefocustakeFocusTakeFocus-textvariabletextVariableVariablewrong # args: should be " pathName ?options?" option ?arg arg ...?" cget option"configurebad option "": must be cget or configure-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-exportselectionexportSelectionExportSelectionforegroundHelvetica -12 bold-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-selectmodeselectModeSelectMode-setgrid-takefocustakeFocusTakeFocus-xscrollcommandxScrollCommandScrollCommand-yscrollcommandyScrollCommandScrollCommandwrong # args: should be " pathName ?options?" option ?arg arg ...?"activate activate index" bbox index"%d %d %d %d cget option"configurecurselection curselection"ListboxWidgetCmd: selection count incorrect delete firstIndex ?lastIndex?" get first ?last?" index index" insert index ?element element ...?" nearest y" scan mark|dragto x y"bad scan option "": must be mark or dragto see index"selection selection option index ?index?" selection anchor index"includes selection includes index"bad selection option "": must be anchor, clear, includes, or setbad option "": must be activate, bbox, cget, configure, curselection, delete, get, index, insert, nearest, scan, see, selection, size, xview, or yviewbad listbox index "": must be active, anchor, end, @x,y, or a number (vertical scrolling command executed by listbox) (horizontal scrolling command executed by listbox)Unknown display passed to Tk_CreateErrorHandler-outline-splinesteps-stipplewrong # args: should be " create x1 y1 x2 y2 x3 y3 ?x4 y4 ...? ?options?"too few coordinates for polygon: must have at least 6odd number of coordinates specified for polygongrestore gsave %d setlinewidth 1 setlinecap 1 setlinejoin -background-foreground-maskdata-maskfilecan't have mask without bitmapbitmap and mask have different sizes (while configuring image "can't get bitmap data from a file in a safe interpretercouldn't read bitmap file "format error in bitmap data; looks like it's an obsolete X10 bitmap fileformat error in bitmap datawrong # args: should be "%.50s option ?arg arg ...?"wrong # args: should be " cget option"configurebad option "": must be cget or configuretried to delete bitmap image when instances still exist-activebackgroundactiveBackgroundForeground-activebackgroundactiveBackgroundForeground-activereliefactiveRelief-backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-command-elementborderwidthelementBorderWidthBorderWidth-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThicknessvertical-repeatdelayrepeatDelayRepeatDelay-repeatintervalrepeatIntervalRepeatInterval-takefocustakeFocusTakeFocus-troughcolortroughColorBackground-troughcolortroughColorBackgroundwrong # args: should be " pathName ?options?"Scrollbar option ?arg arg ...?"activate activate element" cget option"configure delta xDelta yDelta"fraction fraction x y"%d %d %d %didentify identify x y" set firstFraction lastFraction" or " set totalUnits windowUnits firstUnit lastUnit"bad option "": must be activate, cget, configure, delta, fraction, get, identify, or setverticalhorizontalbad orientation "": must be vertical or horizontaltcl_interactiveApplication initialization failederrorInfoError in startup scripttcl_prompt2tcl_prompt1 (script that generates prompt)couldn't read GIF header from file "GIF image file "" has dimension(s) <= 0error reading color maperror reading extension function code in GIF imageerror reading extension in GIF imagecouldn't read left/top/width/height in GIF imageinline dataerror reading GIF image: format error in GIF image | d d d d d d d d l l d l l d d d d d d d d d d d d d d d d d d l d d d d d d d d d d \ d d d d     $ , 4 < D L T d d d t d d d l t |                     $ , 4 d d d d d d < D L T \ d l t |                 -backgroundbackgroundBackground-backgroundbackgroundBackgroundborderWidthbackground-borderwidthborderWidthBorderWidth-exportselectionexportSelectionExportSelectionforegroundHelvetica -12-foregroundforegroundForeground-highlightbackgroundhighlightBackgroundHighlightBackground-highlightcolorhighlightColorHighlightColor-highlightthicknesshighlightThicknessHighlightThickness-insertbackgroundinsertBackgroundForeground-insertborderwidthinsertBorderWidthBorderWidth-insertborderwidthinsertBorderWidthBorderWidth-insertofftimeinsertOffTime-insertontimeinsertOnTime-insertwidthinsertWidthInsertWidth-justify-selectbackgroundselectBackgroundForeground-selectbackgroundselectBackgroundForeground-selectborderwidthselectBorderWidthBorderWidth-selectborderwidthselectBorderWidthBorderWidth-selectforegroundselectForegroundBackground-selectforegroundselectForegroundBackground-takefocustakeFocusTakeFocus-textvariabletextVariableVariable-xscrollcommandxScrollCommandScrollCommandwrong # args: should be " pathName ?options?" option ?arg arg ...?" bbox index"%d %d %d %d cget option"configure delete firstIndex ?lastIndex?" icursor pos" index string" insert index text" scan mark|dragto x"bad scan option "": must be mark or dragtoselection select option ?index?" selection clear" selection present" selection adjust index" selection from index" selection range start end" selection to index"bad selection option "": must be adjust, clear, from, present, range, or tobad option "": must be bbox, cget, configure, delete, get, icursor, index, insert, scan, selection, or xviewbad state value "": must be normal or disabledbad entry index "selection isn't in entrysel.firstsel.last (horizontal scrolling command executed by entry)Tcl_SetListObj called with shared objectTcl_ListObjAppendList called with shared objectTcl_ListObjAppendElement called with shared objectTcl_ListObjReplace called with shared objectSetListFromAny: bad size estimate for listblocking buffering buffersize eofchar translationerror setting blocking mode: -blockingTcl_RegisterChannel: channel without nameTcl_RegisterChannel: duplicate channel namescan not find channel named "Tcl_CreateChannel: NULL channel nameunable to access channel: invalid channelBlocking channel driver did not block on outputTclFlush, closed channel: queued output leftFlushChannel: damaged channel listcalled Tcl_Close on channel with refCount > 0Tcl_Write: AUTO output translation mode not supportedTcl_Write: unknown output translation modeBlocking channel driver did not block on inputunknown eol translation modemalformed option list in channel driverbad option "": should be one of -buffering-buffersize-eofchar-translationunable to set channel options: background copy in progressbad value for -buffering: must be one of full, line, or nonebad value for -eofchar: should be a list of one or two elementsbad value for -translation: must be a one or two element listplatformbad value for -translation: must be one of auto, binary, cr, lf, crlf, or platformwrong # args: must be " channelId event ?script?readablewritablebad event name "": must be readable or writablechannel is not wrong # args: should be " subcommand ?additional args..?" info channelName"nonblockingblockingasync_flushunblockedqueued_crinputbufferedchannel name requiredoutputbufferedqueuedcrrefcount": should be info, open, readable, or writable channelName cmd ?arg1? ?arg2?" channelName add eventSpec script" channelName delete index"bad event index: : must be nonnegativebad event index : out of rangeTclTestChannelEventCmd: damaged event script list channelName list"removeall channelName removeall"bad command , must be one of add, delete, list, or removeallchannel "" is busyerror reading "error writing "integer value too large to representTcl_SetBooleanObj called with shared objectexpected boolean value but got "%.50s"Tcl_SetDoubleObj called with shared objectexpected floating-point number but got "%.50s"Tcl_SetIntObj called with shared objectexpected integer but got "%.50s"IOVERFLOWTcl_SetLongObj called with shared objectbad value for -mode%d,%c,%d,%d%d,%c,%d,%d%n: should be baud,parity,data,stop parity: should be n, o, e, m, or s data: should be 5, 6, 7, or 8 stop: should be 1 or 2Tcl_OpenFileChannel: invalid mode valuecouldn't open "couldn't seek to end of file on "-translationauto crlf-peernamecan't get peername: -socknamecan't get sockname: peername socknamecouldn't open socket: TclGetDefaultStdChannel: Unexpected channel type-buffering" wasn't opened for writing" wasn't opened for readingcannot get a FILE * for "" cannot be used to get a FILE *TclWaitForFile can't handle file id %dillegal access mode " while processing open access modes "NONBLOCKinvalid access mode "": must be RDONLY, WRONLY, RDWR, APPEND, CREAT EXCL, NOCTTY, NONBLOCK, or TRUNCaccess mode must include either RDONLY, WRONLY, or RDWRcouldn't read file " (file "%.150s" line %d)option ?arg arg ...?tclAfterafter#%dbad argument "": must be cancel, idle, info, or a numberid|commandscript script ..." doesn't exist ("after" script)no such variablevariable is arrayvariable isn't arrayno such element in arrayupvar refers to element in deleted arrayparent namespace doesn't existmissing variable namedonesearchnextelementstartsearchwrong # args: should be " varName ?newValue?" (reading value of variable to increment)varName ?varName ...?varName ?value value ...?option arrayName ?arg ...? ~ ~ <    d  arrayName searchIdarrayNamearrayName ?pattern?arrayName listlist must have an even number of elements" isn't an arraybad variable name "": unknown namespacecan't upvar from variable to itselfvariable "" already exists" has traces: can't use for upvar?level? otherVar localVar ?otherVar localVar ...?illegal search identifier "search identifier "" isn't for variable "couldn't find search "continuefileeventlreplacenamespacevariablefblockedfconfigureTcl_CreateInterp: can't create global namespaceTcl_CreateInterp: builtin command with NULL string and object command procs and a NULL compile proc tcl_patchLeveltcl_versiontcl_precisionlittleEndianbigEndiantcl_platformbyteOrderAssoc Data Key #%dDeleteInterpProc called with active evalsDeleteInterpProc called on interpreter not marked deletedcannot use namespace qualifiers as hidden commandtoken (rename)can only hide global namespace commands (use rename then hide)tclHiddenCmdshidden command named "" already existscan not expose to a namespace (use expose to toplevel, then rename)unknown hidden command "trying to expose a non global command name space commandexposed command "": command doesn't existcan't rename to "": bad command name": command already existstoo many nested calls to Tcl_EvalObj (infinite loop?)attempt to call eval in deleted interpreterinvoked "break" outside of a loopinvoked "continue" outside of a loopcommand returned bad code: %d while executing "%.*s%s" invoked from within "%.*s%s"expression didn't have numeric valueillegal argument vectorinvalid hidden command name "invalid command name " while invoking " invoked from within "errorInfoerrorCodeinvokeStk1invokeStk4loadScalar1loadScalar4loadScalarStkloadArray1loadArray4loadArrayStkstoreScalar1storeScalar4storeScalarStkstoreArray1storeArray4storeArrayStkstoreStkincrScalar1incrScalarStkincrArray1incrArrayStkincrScalar1ImmincrScalarStkImmincrArray1ImmincrArrayStkImmincrStkImmjumpTrue1jumpTrue4jumpFalse1jumpFalse4callBuiltinFunc1callFunc1tryCvtToNumericcontinueforeach_start4foreach_step4beginCatch4endCatchpushResultpushReturnCodebytecode ByteCode 0x%x, ref ct %u, epoch %u, interp 0x%x(epoch %u) Source Cmds %d, chars %d, inst %d, objs %u, aux %d, stk depth %u, code/src %.2f Code %d = %d(header)+%d(inst)+%d(objs)+%d(exc)+%d(aux)+%d(cmd map) Proc 0x%x, ref ct %d, args %d, compiled locals %d , scalar %d: slot %d%s%s%s%s%s, name="%s" Exception ranges %d, depth %d: %d: level %d, %s, pc %d-%d, continue %d, break %d catch %d TclPrintSource: unrecognized ExceptionRange type %d Commands %d:%s%4d: pc %d-%d, source %d-%d Command %d: (%u) %s %d # pc %uTclPrintInstruction: bad local var index %u (%u locals) %u # temp var %u%u # var tcl_traceCompileSetByteCodeFromAny: unable to create link for tcl_traceCompile variableUpdateStringOfByteCode should never be called.TclInitByteCodeObj: encoded cmd location bytes %d != expected size %d GetCmdLocEncodingSize: bad code offsetGetCmdLocEncodingSize: bad code lengthGetCmdLocEncodingSize: bad source lengthEncodeCmdLocMap: bad code offsetEncodeCmdLocMap: bad code lengthEncodeCmdLocMap: bad source lengthCompiling: %.*s%s extra characters after close-quoteextra characters after close-brace while compiling "%.*s%s"missing close-bracketmissing %cmissing close-bracemissing close-brace for variable name (parsing index for array "%.*s")wrong # args: should be "break"wrong # args: should be "catch command ?varName?" ("catch" body line %d)TclCompileCatchCmd: bad jump distance %d wrong # args: should be "continue"wrong # args: should be "expr arg ?arg ...?"wrong # args: should be "for start test next command" ("for" initial command) ("for" test expression) ("for" body line %d) ("for" loop-end command)wrong # args: should be "foreach varList list ?varList list ...? command" ("foreach" body line %d)wrong # args: no expression after "if" argument ("if" test expression)wrong # args: no script following "%.20s" argumentwrong # args: no script following "then" argument ("if" then script line %d)wrong # args: no expression after "elseif" argumentwrong # args: no script following "else" argument ("if" else script line %d)wrong # args: extra words after "else" clause in "if" commandTclCompileIfCmd: unexpected opcode updating ifFalse jumpwrong # args: should be "incr varName ?increment?" (increment expression)wrong # args: should be "set varName ?newValue?"wrong # args: should be "while test command" ("while" test expression) ("while" body line %d)malformed expression wordEnterCmdStartData: bad command index %d EnterCmdStartData: cmd map table not sorted by code offsetEnterCmdStartData: no start data registered for command with index %d quoted string doesn't terminate properlyargument word in braces doesn't terminate properlymissing close-bracket or close-braceTclFixupForwardJump: unrecognized ExceptionRange type %d -command-nonewline?-nonewline? ?channelId? stringnonewlinebad argument "": should be "nonewline"channel "" wasn't opened for writingerror writing "channelIderror flushing "channelId ?varName?" wasn't opened for readingerror reading "channelId ?numBytes? ?-nonewline? channelId"wrong # args: should be " channelId offset ?origin?"bad origin "": should be start, current, or enderror during seek on " channelId" channelId ?optionName? ?value? ?optionName value?..."-keepnewlinebad switch "": must be -keepnewline or -- ?switches? arg ?arg ...?"error reading output from command: fileName ?access? ?permissions?"Tcl_OpenCmd: invalid mode valuetclTCPAcceptCallbacksRegisterTcpServerCleanup: damaged accept record tablecannot set -async option for server socketsno argument given for -server optionno argument given for -myaddr optionno argument given for -myport optionbad option "", must be -async, -myaddr, -myport, or -serverOption -myport is not valid for serverswrong # args: should be either: ?-myaddr addr? ?-myport myport? ?-async? host port -server command ?-myaddr addr? portinput output ?-size size? ?-command callback?^(([a-zA-Z]:)|[/\][/\]+([^/\]+)[/\]+([^/\]+)|([/\]))([/\])*^((/+([.][.]?/+)*([.][.]?)?)|(~[^:/]*)(/[^:]*)?|(~[^:]*)(:.*)?|/+([.][.]?/+)*([^:/]+)(/[^:]*)?|([^:]+):.*)$couldn't find HOME environment variable to expand path" doesn't exist-nocomplainbad switch "": must be -nocomplain or --wrong # args: should be " ?switches? name ?name ...?"globbing characters not supported in user namesno files matched glob patternunmatched open-brace in file nameunmatched close-brace in file nameattributesexecutableextensionisdirectorynativenamepathtypereadablereadlinkrootnamewritablewrong # args: should be "string ?in? patList body ... ?default body?extra case pattern with no body ("%.*s" arm line %d)command ?varName?couldn't save command result in variablemessage ?errorInfo? ?errorCode?errorCodearg ?arg ...? ("eval" body line %d)?returnCode?option ?arg ...?name ?arg ...? >D ? B B0 ?t >D >D ? >D >D ? >D >D A| C >D ?  >D >D @ ? >D ? >D ?dirname nametail namerootname nameextension namepathtype nameabsoluterelativevolumerelativesplit namereadable namewritable nameexecutable nameexists name Eh Dt Dt Dt Dt Dt Dt Dt E E Dt E E Dt Dt F  Dt Dt F( Dt Dt FD Dt F` Dt Fatime nameisdirectory nameisfile namelstat name varNamecouldn't lstat "mtime nameowned namereadlink namecouldn't readlink "size namestat name varNamecouldn't stat "type namedirectorycharacterSpecialblockSpecial start test next command" ("for" initial command) ("for" body line %d) ("for" loop-end command)varList list ?varList list ...? commandforeach varlist is emptyTcl_ForeachObjCmd: could not reconvert variable list %d to a list object Tcl_ForeachObjCmd: could not reconvert value list %d to a list object couldn't set loop variable: " ("foreach" body line %d)formatString ?arg arg ...? h\ g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, h g, h g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, g, f g, g, g, g, g, g, g, g, g, g, g f h h h g, f g, g, g, g, g, f g, g, g, f g, f g, g, fformat string ended in middle of field specifierbad field specifier "%c"cannot mix "%" and "%n$" conversion specifiers"%n$" argument index out of rangenot enough arguments for all format specifierstrimlefttrimrightwordstartwrong # args: should be " ?switches? exp string ?matchVar? ?subMatchVar subMatchVar ...?"-indicesbad switch "": must be -indices, -nocase, or --couldn't set variable " ?switches? exp string subSpec varName"": must be -all, -nocase, or --oldName newNamecontinuebad completion code "": must be ok, error, return, break, continue, or an integer-errorinfo-errorcodebad option "": must be -code, -errorcode, or -errorinfo string format ?varName varName ...?"too many fields to scan                         L  @   field width may not be specified in %c conversionunmatched [ in format stringbad scan conversion character "%c"different numbers of variable names and field specifiersfileNamestring ?splitChars?option arg ?arg ...? p    X   , p   ( 0 xstring1 string2string charIndexpattern stringstring first laststring ?chars?string index": must be -nobackslashes, -nocommands, or -novariables-nobackslashes-nocommands-novariables ?-nobackslashes? ?-nocommands? ?-novariables? string"?switches? string pattern body ... ?default body?extra switch pattern with no bodyno body specified for pattern " ("%.50s" arm line %d)command ?count?%.0f microseconds per iterationtoo few args: should be " option [arg arg ...]"variable variable name ops command" vdelete name ops command" vinfo name"": should be variable, vdelete, or vinfobad operations "": should be one or more of rwu test command" ("while" body line %d)BUILTIN FUNCTIONFUNCTIONtcl_traceExecInitByteCodeExecution: can't create link for tcl_traceExec variable Starting stack top=%d   (  4 (  $  x 0 <        ׌   ܜ      0   D  t D P t ,  8               !$%%()*,d0011x TclExecuteByteCode: done instruction at pc %u: stack top %d != entry stack top %d Source: TclExecuteByteCode execution failure: end stack top != start stack topattempt to call eval in deleted interpreterinvalid command name "%d: (%u) invoking TclExecuteByteCode: unrecognized ExceptionRange type %d TclExecuteByteCode: unrecognized builtin function code %dTclExecuteByteCode: unrecognized opCode %udivide by zero while executing "%.*s%s" invoked from within "%.*s%s" Executing ByteCode 0x%x, ref ct %u, epoch %u, interp 0x%x(epoch %u) Cmds %d, chars %d, inst %u, objs %u, aux %d, stk depth %u, code/src %.2fn Code %d = %d(header)+%d(inst)+%d(objs)+%d(exc)+%d(aux)+%d(cmd map) Proc 0x%x, ref ct %d, args %d, compiled locals %d can't use empty string as operand of "floating-point valuenon-numeric stringcan't use as operand of "argument to math function didn't have numeric valueinteger value too large to representIOVERFLOW as argument to srandunknown math function "ExprCallMathFunc: expected number of args %d != actual number %ddomain error: argument not in valid rangefloating-point value too small to representUNDERFLOWfloating-point value too large to representOVERFLOWunknown floating-point error, errno = %dUpdateStringOfCmdName should never be invokedchildrenqualifiersnamespace "" not found in context "can't create namespace "": only global namespace can have empty namecan't create namespace "": already existserrorInfoerrorCodeinvalid export pattern "": pattern can't specify a namespaceempty import patternunknown namespace in import pattern "no namespace specified in import pattern "import pattern "" tries to import from namespace "" into itselfcan't import command "unknown namespace in namespace forget pattern "DeleteImportedCmd: did not find cmd in real cmd's list of import referencesunknown namespace "unknown command "unknown variable "subcommand ?arg ...?@h0X" in namespace children command?name? ?pattern?namespace?name name...?" in namespace delete commandname arg ?arg...? (in namespace eval "%.200s" script line %d)?-clear? ?pattern pattern...??pattern pattern...??-force? ?pattern pattern...?" in inscope namespace command (in namespace inscope "%.200s" script line %d)invalid command name "" in namespace parent command?-command? ?-variable? name-command-variableexpected integer but got "integer value too large to representIOVERFLOWexpected floating-point number but got "expected boolean value but got "NULL argumentregexp too bigout of spacetoo many ()unmatched ()junk on end*+ operand could be emptynested *?+xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxdxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxtxxxxxxxxxxxxxxxxxxxxxxxxxxxxxinvalid [] rangeunmatched []internal urp?+* follows nothingtrailing \^$.[()|?+*\internal disasterNULL parametercorrupted programɨ<d(Ȍ<<LLLLLLLLLLLLLLLLLLLLDŽDŽDŽDŽDŽDŽDŽDŽDŽmemory corruptioncorrupted pointersinternal foulupcmdcountcommandscompletehostnamenameofexecutablepatchlevelsharedlibextensiontclversion-command-decreasing-dictionary-increasing-integerwrong # args: no expression after "" argumentwrong # args: no script following "wrong # args: no script following "else" argumentwrong # args: should be " varName ?increment?" (reading value of variable to increment) (reading increment)option ?arg arg ...?@h0Xߌ Hpprocname" isn't a procedure?pattern?procname arg varnamecouldn't store default value in variable "procedure "" doesn't have an argument "bad level "?number?tcl_libraryno library has been specified for Tcl?interp?tcl_patchLeveltcl_versionlist ?joinString?list indexlist index element ?element ...?list first lastlist first last ?element element ...?list doesn't contain element search mode?mode? list pattern?options? list `"-command" option must be followed by comparison command"-index" option must be followed by list indexelement missing from sublist " (-compare command)-compare command returned non-numeric resultcouldn't change working directory to "working directory name is too longerror getting working directory name: :/bin:/usr/bincouldn't read directory "conflicting versions provided for package " ("package ifneeded" script) ("package unknown" script)can't find package version conflict for package "": have wrong # args: should be " option ?arg arg ...?"ifneeded ifneeded package version ?script?" provide package ?version?" require ?-exact? package ?version?" unknown ?command?"vcompare vcompare version1 version2"versions versions package"vsatisfies vsatisfies version1 version2"bad option "": should be forget, ifneeded, names, provide, require, unknown, vcompare, versions, or vsatisfiesexpected version number but got "wrong # args: should be " fileName ?packageName? ?interp?"must specify either file name or package namecouldn't find slave interpreter named "" is already loaded for package "package "" isn't loaded staticallycouldn't figure out package name for _SafeInitcouldn't find procedure can't use package in a safe interpreter: _SafeInit procedureerrorInfoerrorCodeTcl_Release couldn't find reference for 0x%xTcl_EventuallyFree called twice for 0x%x 0123456789list element in braces followed by "%.*s" instead of spacelist element in quotes followed by "%.*s" %sinstead of spaceunmatched open brace in listunmatched open quote in listinternal error in Tcl_SplitList[4[4[4[4[4ZZZZZZZZZZZZZZZZZZ[4ZZZ[4ZZZZZZZZZZZZZZZZZZZZZZ[4ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[4[<ZZZZZZZZZZZZZZZZZZZZZZZZZZZZZZ[,ZZ]8]]H]](\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\\errorCodecouldn't compile regular expression pattern: error while matching regular expression: can't modify precision from a safe interpreterimproper value for precisionbad index "": must be integer or "end"option ?arg arg ...?formatString ?arg arg ...?  ((((( (((((((((((((((((((((  x(( (((((((((((((number of elements in list does not match countcannot use "*" in format string with "x"bad field specifier "lxl<hexadecimalvalue formatString ?varName varName ...?@@@@@8@@@@@@@@@0@@@@@@@@@@@@(@@@8@@@@@@@@@0@@@@Hexpected string but got "" insteadmissing count for "@" field specifiernot enough arguments for all format specifiersX$(invokehiddenmarktrustedtransferinvokehiddenmarktrustedcannot define or rename alias "": would create a looptcl_platformosVersiontcl_librarytcl_pkgPathtclMasterRecordinterpreter named "" not found" already exists, cannot createCreateSlave: out of memory while creating a new interpretertclSlaveRecordtcl_interactiveerrorInfoerrorCode?-safe? ?--? ?path?bad option "": should be -safeinterp%dbad interpreter path "AliasCreationHelper: could not find slave recordmalformed command: should be "alias interpreter "slavePath slaveCmd masterPath masterCmd ?args ..?could not find interpreter "path arg ?arg ...?path hiddenCmdName ?cmdName?permission denied: safe interpreter cannot expose commandspath cmdName ?hiddenCmdName?permission denied: safe interpreter cannot hide commandstclHiddenCmdspath ?-global? cmd ?arg ..?not allowed to invoke hidden commands from safe interpreter marktrusted" can only be invoked from a trusted interpretersrcPath channelId destPathpath aliasDescribeAlias: could not find slave recordDeleteAlias: did not find alias to be deletedTcl_GetInterpPath: could not find master recordGetTarget: could not find master recordGetTarget: could not find slave record" in path "GetTarget: could not find alias recordtarget interpreter for alias "" is not my descendantcmd ?arg ...?Tcl_InterpCmd: could not find master recordH|LP aliasName ?targetName? ?args..?SlaveObjectCmd: could not find master recordarg ?arg ...?hiddenCmdName ?cmdName?cmdName ?hiddenCmdName??-global? cmd ?arg ..? marktrusted" can only be invoked from a trusted interpreterinterpreter has been deletedSlaveObjectCmd: could not find slave record@|0l SlaveObjectDeleteProc: could not find slave recordinvoked "break" outside of a loopinvoked "continue" outside of a loopcommand returned bad code: %dSlaveRecordDeleteProc: NULL slavePtrCreatSlave: could not find master recordTcl_GetSlave: could not find master recordTcl_CreateAlias: could not find master recordTcl_GetAlias: could not find slave recordcouldn't create pipe: %dforked process couldn't set up input/output: %dcouldn't execute "%.150s": couldn't fork child process: ?channelId?internal error: bad linked variable typelinked variable is read-onlyinternal error: linked variable couldn't be readvariable must have integer valuevariable must have real valuevariable must have boolean valueerrorInfoerrorCodetclBgErrortclHiddenCmds"bgerror" is an invalid command name or ambiguous abbreviationbgerror failed to handle background error. Original error: Error in bgerror: wrong # args: should be "can't wait for variable "": would wait foreveridletasksbad option "": must be idletasks ?idletasks?"name args bodycan't create procedure "": unknown namespace": bad procedure name" in non-global namespace with name starting with ":"too many fields in argument specifier "procedure "" has argument with no name" has formal parameter "" that is an array elementbad level "?level? command ?arg ...? ("uplevel" body line %d)Compiling body of proc "%.*s%s" (compiling body of proc "%.*s%s", line %d)TclObjInterpProc: local variable %s is not argument but should beTclObjInterpProc: local variable %d is temporary but should be an argumentno value given for parameter "called "" with too many argumentsCalling proc (procedure "%.50s" line %d)invoked "break" outside of a loopinvoked "continue" outside of a looperrorCodeerrorInfoambiguous ": must be can't convert value to index except via Tcl_GetIndexFromObj APIUpdateStringOfIndex should never be invokedwrong # args: should be "missing %cmissing close-bracemissing close-brace for variable name (parsing index for array "%.*s")wrong # args: should be " ?options? source ?source ...? target"renaming: target "" is not a directorycan't create directory " ?options? file ?file ...?"error deleting "": directory not emptycan't overwrite file "" with directory "can't overwrite directory "" with file "error renaming "": trying to rename a volume or move a directory into itselfcan't unlink "error copying "bad option "": should be -force or --wrong # args: must be "file attributes name ?option? ?value? ?option value? ..."-permissionscould not stat file "could not get group for file "could not get owner for file "could not set group for file "": group "" does not existcould not set owner for file "": user "could not set permissions for file "channel "" wasn't opened for couldn't can't specify "" as last word in commandchild process lost (is SIGCHLD ignored or trapped?)error waiting for process to exit: CHILDSTATUSCHILDKILLEDchild killed: CHILDSUSPchild suspended: child wait status didn't make sense error reading stderr output file: child process exited abnormallyillegal use of | or |& in commandcouldn't create input file for command: couldn't create input pipe for command: couldn't create output pipe for command: couldn't create error file for command: couldn't create pipe: can't read output from command: standard output was redirectedcan't write input to command: standard input was redirectedpipe for command could not be created$ L<D$ hd8DT4@H|,,$,4<x pLTP4\@PXtl`,\ xd|XHlpEADDRINUSEEADDRNOTAVAILEAFNOSUPPORTEALREADYECONNABORTEDECONNREFUSEDECONNRESETEDEADLOCKEDESTADDRREQEHOSTDOWNEHOSTUNREACHEINPROGRESSEL2NSYNCELIBEXECEMSGSIZEEMULTIHOPENAMETOOLONGENETDOWNENETRESETENETUNREACHENOPROTOOPTENOTCONNENOTEMPTYENOTSOCKENOTUNIQEOPNOTSUPPEPFNOSUPPORTEPROCLIMEPROTONOSUPPORTEPROTOTYPEEREMOTEIOESHUTDOWNESOCKTNOSUPPORTETIMEDOUTETOOMANYREFSunknown error8t(PL\p|x<h$,Hd|d@TX(888L0`t<88pl\  <8888888$,8T88hP488888888888888888888`Dd@88P(x8888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888888xargument list too longpermission deniedaddress already in usecan't assign requested addressadvertise erroraddress family not supported by protocol familyresource temporarily unavailableoperation already in progressbad exchange descriptorbad file numberfile descriptor in bad statenot a data messagebad request descriptorbad request codeinvalid slotbad font file formatfile busyno childrenchannel number out of rangecommunication error on sendsoftware caused connection abortconnection refusedconnection reset by peerresource deadlock avoideddestination address requiredmath argument out of rangedisk quota exceededfile already existsbad address in system call argumentfile too largehost is downhost is unreachableidentifier removedinitialization erroroperation now in progressinterrupted system callinvalid argumentI/O errorsocket is already connectedillegal operation on a directorylevel 2 haltedlevel 2 not synchronizedlevel 3 haltedlevel 3 resetcan not access a needed shared libraryaccessing a corrupted shared librarycan not exec a shared library directlyattempting to link in more shared libraries than system limit.lib section in a.out corruptedlink number out of rangetoo many levels of symbolic linkstoo many open filestoo many linksmessage too longmultihop attemptedfile name too longnot availablenetwork is downnetwork dropped connection on resetnetwork is unreachablefile table overflowanode table overflowno buffer space availableno CSI structure availableno data availableno such deviceno such file or directoryexec format errorno locks availablelink has be severednot enough memoryno message of desired typemachine is not on the networkpackage not installedbad proocol optionno space left on deviceout of stream resourcesnot a stream devicefunction not implementedblock device requiredsocket is not connectednot a directorydirectory not emptynot a name filesocket operation on non-socketoperation not supportedinappropriate device for ioctlname not unique on networkno such device or addressoperation not supported on socketnot ownerprotocol family not supportedbroken pipetoo many processesprotocol errorprotocol not supporedprotocol wrong type for socketmath result unrepresentableremote address changedremote devicepathname hit remote file systemremote i/o errorread-only file systemcan't send afer socket shutdownsocket type not supportedinvalid seekno such processsrmount errorstale remote file handletimer expiredconnection timed outtoo many references: can't splicetext file or pseudo-device busystructure needs cleaningprotocol driver not attachedtoo many userscross-domain linkmessage tables full$4d,ÌDl|LÄôü\ì<tÔ ÜäTSIGVTALRMSIGWINCHunknown signal$ĀĔĈ0htĬDĸ8P\PtDĠ \,8hŀŌalarm clockbus errorchild status changedcontinue after stopEMT instructionfloating-point exceptionillegal instructioninterruptinput/output possible on filekill signalwrite on pipe with no readersprofiling alarmpower-fail restartquit signalsegmentation violationbad argument to system callsoftware termination signaltrace trapstop signal from ttybackground tty readbackground tty writeurgent I/O conditionuser-defined signal 1user-defined signal 2virtual time alarmwindow changedexceeded CPU time limitexceeded file size limitTcl_SetStringObj called with shared objectTcl_SetObjLength called with shared objectTcl_AppendToObj called with shared objectTcl_AppendStringsToObj called with shared objectunable to alloc %d bytesunable to alloc %d bytes, %s line %dunable to realloc %d bytesunable to realloc %d bytes, %s line %dmalformed bucket chain in Tcl_DeleteHashEntry%d entries in table, %d buckets number of buckets with %d entries: %d number of buckets with %d or more entries: %d average search distance for entry: %.1fcalled Tcl_FindHashEntry on deleted tablecalled Tcl_CreateHashEntry on deleted table$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.29 $$Revision: 1.4 $$Revision: 7.41 $$Revision: 1.78 $$Revision: 1.41 $$Revision: 1.28 $$Revision: 3.42 $$Revision: 1.24 $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $$Revision: 3.73 $$Revision: 1.35 $$Revision: 1.57 $$Revision: 3.144 $$Revision: 1.8 $$Revision: 1.26 $$Revision: 1.36 $$Revision: 1.5 $$Revision: 1.11 $$Revision: 3.90 $$Revision: 1.35 $$Revision: 3.21 $$Revision: 3.71 $$Revision: 3.62 $$Revision: 3.53 $$Revision: 1.51 $$Id: ptimers.h,v 1.4 1997/01/15 04:44:41 jwag Exp $$Revision: 1.46 $$Revision: 1.137 $@(#)uts-3b2:io/uio.h 1.2$Revision: 1.22 $$Revision: 1.9 $$Revision: 1.1 $$Revision: 3.35 $$Revision: 1.8 $$Revision: 1.12 $$Revision: 1.25 $/usr/csbmb/lib/tcl8.0/usr/csbmb/libtcl_librarytcl_pkgPathtcl_platformplatformunixososVersion.machinetcl_rcFileNamer $Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.29 $$Revision: 1.4 $$Revision: 7.41 $$Revision: 1.78 $$Revision: 1.41 $dynamic loading is not currently available on this systemcouldn't open socket: port number too highEnvTraceProc called with confusing argumentsEnvTraceProc couldn't find interpreterinteger value too large to representTclCompileExpr: Tcl_CreateMathFunc incorrectly registered '%s'syntax error in expression "CompileLorExpr: bad jump distance %d CompileLandExpr: bad jump distance %d missing close-bracketCompilePrimaryExpr: unexpected termination char '%c' for nested command unknown math function "too many arguments for math functiontoo few arguments for math functionIOVERFLOWmissing close-brace53L/t3,354/t23 333l4 /t3/t/t/t/t/t/t/t/t/t/t4L/t4l444,/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t2/t25`/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t/t5/t5%a %b %d %X %Z %Yoption ?arg ...?clockval ?-format string? ?-gmt boolean?dateString ?-base clockValue? ?-gmt boolean?unable to convert date-time string "bad format string "februaryseptembernovemberdecemberwednesdaythursdaysaturdayfortnighttomorrowyesterdayyacc stack overflowsyntax errorTTT[ [0[@[P[`T[p[[[\ \x\\\\\\\] ] ]<]P]d]T]]]^^$^8^@^`^^^^$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Id: wnrtl.c,v 1.6 2002/03/22 20:29:58 wn Exp $$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.29 $$Revision: 1.4 $$Revision: 1.78 $$Revision: 1.41 $$Id: search.c,v 1.161 2003/06/23 15:52:27 wn Exp $WordNet library error: %s indexfile not open %s:%u: failed assertion `%s' search.cidx idx->wdidx->posidx->ptruseidx->offsetWordNet library error: %s datafile not open synptrWordNet library error: no synset at location %d synptr->possynptr->wordssynptr->wnsnssynptr->lexidsynptr->words[i]%xsynptr->ptrtypsynptr->ptroffsynptr->ppossynptr->ptosynptr->pfrmsynptr->frmidsynptr->frmto (1 + strlen(tbuf)) < sizeof(tbuf)synptr->defn(%s)%c:%8.8dDerived from %s Pertains to %s Antonym of Participle of verb HAS MEMBER: HAS SUBSTANCE: HAS PART: MEMBER OF: SUBSTANCE OF: PART OF: => (Sense %d) => v\wDwDwDwDvw w(vvvwDwDwDvwDu-> CATEGORY->(USAGE->(REGION->(CATEGORY_TERM->(USAGE_TERM->(REGION_TERM->() RELATED TO->(%s) #%d EX: %s%%%-1.1d:%-2.2d:%-2.2d:: , , => *> an adverban adjectivea verba nounextremely familiarvery familiarfamiliarcommonuncommonrarevery rareextremely rare %s used as %s is %s (polysemy count = %d) WordNet library error: Can't perform compounds search because %s index file is not open %s rel-------------- 1 sense of %s %d senses of %s %d of %d senses of %s Search Interrupted... Search too large. Narrow search and try again... ||||l||||LpdP($Dsynptr->headword %d. (%d) %d. The %s %s has 1 sense The %s %s has %d senses (first %d from tagged texts) (no senses from tagged texts) QWordNet library error: Error Cycle detected %s (a)(ip)(p){%8.8d} <%s> , -- INDIRECT (VIA %s, %s) -> (postnominal)(prenominal)(predicate)%d#%d Sense %d in file "%s" Sense %d $Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.29 $$Revision: 1.4 $$Revision: 1.43 $$Revision: 3.55 $ $Author: joecd $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $$Revision: 1.41 $$Revision: 7.41 $$Revision: 3.38 $$Revision: 3.71 $$Revision: 1.78 $WNDBVERSION%s:%u: failed assertion `%s' wnutil.cwnreleaseWNSEARCHDIRWNHOME%s%s/dict/usr/local/WordNet-2.0/dict%s/data.%srWordNet library error: Can't open datafile(%s) %s/index.%sWordNet library error: Can't open indexfile(%s) %s/index.sense%s/cntlist.rev%s/index.key%s/index.key.rev%s/sents.vrbWordNet library warning: Can't open verb example sentence file(%s) %s/sentidx.vrbWordNet library warning: Can't open verb example sentence index file(%s) WordNet library error: unknown part of speech %s D\\\\\\\\\\\\<\\\TD\\LWordNet library error: Unknown synset type %s                  nounverbadjadvӘԘ՘֘WordNet library error: Sense index file not open %1d<%s> { %s, (%s) }sptr->headword%s%%%-1.1d:%-2.2d:%-2.2d:%s:%-2.2d%s%%%-1.1d:%-2.2d:%-2.2d::%s%%%ssnsidx%s %s %d %d snsidx->sensekeysnsidx->word%s %d %d%6.6d%d %s%s %d1.7.1adj.pplverb.weatherverb.stativeverb.socialverb.possessionverb.perceptionverb.motionverb.emotionverb.creationverb.contactverb.consumptionverb.competitionverb.communicationverb.cognitionverb.changeverb.bodynoun.timenoun.substancenoun.statenoun.shapenoun.relationnoun.quantitynoun.processnoun.possessionnoun.plantnoun.phenomenonnoun.personnoun.objectnoun.motivenoun.locationnoun.groupnoun.foodnoun.feelingnoun.eventnoun.communicationnoun.cognitionnoun.bodynoun.attributenoun.artifactnoun.animalnoun.actnoun.Topsadv.alladj.pertadj.all-r-u-c;r;u;c-;+$=\^<>#%%p%s%m#p#s#m&*~@!advadjverbnoun(ip)(a)(p)Something ----s INFINITIVEIt ----s that CLAUSESomebody ----s VERB-ingSomebody ----s INFINITIVESomebody ----s something with somethingSomebody ----s somebody into V-ing somethingSomebody ----s whether INFINITIVESomebody ----s to INFINITIVESomebody ----s to somebodySomebody ----s that CLAUSESomebody ----s somebody INFINITIVESomebody ----s somebody to INFINITIVESomebody's (body part) ----sSomebody ----s PPSomebody ----s something PPSomebody ----s somebody PPSomebody ----s something on somebodySomebody ----s somebody of somethingSomebody ----s somebody with somethingSomebody ----s something from somebodySomebody ----s something to somebodySomebody ----s somebody somethingSomebody ----s on somethingSomething ----s to somebodySomething ----s somethingSomething ----s somebodySomebody ----s somebodySomebody ----s somethingSomebody ----s AdjectiveSomething ----s Adjective/NounSomething ----s something Adjective/NounSomething is ----ing PPIt is ----ingSomebody ----sSomething ----s$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.41 $$Revision: 1.75 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.11 $$Revision: 1.11 $$Revision: 1.29 $$Revision: 1.4 $$Revision: 1.41 $$Revision: 1.78 $$Id: morph.c,v 1.61 2003/06/23 16:15:39 wn Exp $esteringedesiesmenshescheszesxessesseymanshchzxbetweenaboutforintowithfromdownupoutinoffonofattoWNSEARCHDIRWNHOME%s%s/dict/usr/local/WordNet-2.0/dict%s/%s.excrWordNet library error: Can't open exception file(%s) _-fulss|Display synsets containing antonyms of the search string. If the search string is in a head synset the direct antonym is displayed along with the head synset's satellite synsets. If the search string is in a satellite synset, its indirect antonym is displayed via the head synset A head synset contains at least one word that has a direct antonym in another head synset of the same cluster. A satellite synset represents a concept that is similar in meaning to the concept represented by its head synset. Direct antonyms are a pair of words between which there is an associative bond built up by co-occurrences. Direct antonyms are printed in parentheses following the adjective. The position of an adjective in relation to the noun may be restricted to the prenominal, postnominal or predicative position. Where present these restrictions are noted in parentheses. Senses contained in head synsets are displayed, followed by the head synset containing the search string's direct antonym and its similar synsets, which are indented and preceded by "=>". Senses contained in satellite synsets are displayed followed by the indirect antonym via the satellite's head synset. Display synonyms and synsets related to synsets containing the search string. If the search string is in a head synset the 'cluster's' satellite synsets are displayed. If the search string is in a satellite synset, its head synset is displayed. If the search string is a pertainym the word or synset that it pertains to is displayed. A cluster is a group of adjective synsets that are organized around antonymous pairs or triplets. An adjective cluster contains two or more head synsets that contan antonyms. Each head synset has one or more satellite synsets. A head synset contains at least one word that has a direct antonym in another head synset of the same cluster. A satellite synset represents a concept that is similar in meaning to the concept represented by its head synset. Direct antonyms are a pair of words between which there is an associative bond built up by co-occurrences. Direct antonyms are printed in parentheses following the adjective. The position of an adjective in relation to the noun may be restricted to the prenominal, postnominal or predicative position. Where present these restrictions are noted in parentheses. A pertainym is a relational adjective, usually defined by such phrases as "of or pertaining to" and that does not have an antonym. It pertains to a noun or another pertainym. Senses contained in head synsets are displayed above the satellites, which are indented and preceded by "=>". Senses contained in satellite synsets are displayed with the head synset below. The head synset is preceded by "=>". Pertainym senses display the word or synsets that the search string pertains to. Display synonyms and synsets related to synsets containing the search string. If the search string is a pertainym the word or synset that it pertains to is displayed. A pertainym is a relational adverb that is derived from an adjective. Pertainym senses display the word that the search string is derived from and the adjective synset that contains the word. If the adjective synset is a satellite synset, its head synset is also displayed. $Revision: 1.41 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.78 $$Revision: 1.11 $$Revision: 1.4 $$Revision: 1.137 $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $@(#)uts-3b2:io/uio.h 1.2$Revision: 1.22 $$Revision: 1.9 $$Revision: 1.1 $eh0DT|0(X$Revision: 1.41 $$Id: standards.h,v 1.19 1997/12/15 21:30:25 jph Exp $$Revision: 1.78 $$Revision: 1.11 $$Revision: 1.4 $$Revision: 1.137 $$Revision: 3.138 $$Revision: 1.2 $$Revision: 1.17 $@(#)uts-3b2:io/uio.h 1.2$Revision: 1.22 $$Revision: 1.9 $$Revision: 1.1 $$Revision: 1.75 $&0XX6 `7<5h@`px00pipA``CEDG(mp8mHnPXnKMP`h   f 1x =P( V00  8p`@8HXPX`08@HPX`hpx(8HXhxܰ`@ 4 8(008(@HP X`     0123456789abcdefxtnvr\abtnvfr))( )8)P)h< )x))<)))`)**(` *8*P*h` *x** 8 ***(80*8*@HPX *++`@+(hpx +8+H+X+p+d+++d++X,, ,0\,@,P,`\  ,p,,L,,,P,-- H-0-H-`(H08@$-x--H -PX`--hp-x   (D 08@HD --.P  ..(.8X .H.X.h, `hpx4.x........///(/8/H/X/h/x//|/////00X (08@HPX`hpx  @@5x5 55 (D08 @ 5 H 5PX`55h56@6 6($ 68%  @ @6H6X6h6x666666677(787H7`7X*P+U@EAEt X/P """"""""""""""""""""""""UUUUUUUUUUUUUUUUwwwwwwwwwwwwwwwwUU*f*f F  f*f*f*<**?.,,,,׫U*VU_u]u] U_WWPU  X*X*VU+P ` ` XU*@@@@ +++     DEEE E0E@EPE`EpEEEEEEEEFFF(F8FHFXFhFxFFFFFFFGGG G0G@GPG`GxGGGGGGHH H H0H@HPH`Hpproc tkInit {} { global tk_library tk_version tk_patchLevel env errorInfo rename tkInit {} set errors "" if {![info exists tk_library]} { set tk_library . } set dirs {} if {[info exists env(TK_LIBRARY)]} { lappend dirs $env(TK_LIBRARY) } lappend dirs $tk_library lappend dirs [file join [file dirname [info library]] tk$tk_version] set parentDir [file dirname [file dirname [info nameofexecutable]]] lappend dirs [file join $parentDir tk$tk_version] lappend dirs [file join $parentDir lib tk$tk_version] lappend dirs [file join $parentDir library] set parentParentDir [file dirname $parentDir] if [string match {*[ab]*} $tk_patchLevel] { set dirSuffix $tk_patchLevel } else { set dirSuffix $tk_version } lappend dirs [file join $parentParentDir tk$dirSuffix library] lappend dirs [file join $parentParentDir library] lappend dirs [file join [file dirname [file dirname [info library]]] tk$dirSuffix library] foreach i $dirs { set tk_library $i set tkfile [file join $i tk.tcl] if {[interp issafe] || [file exists $tkfile]} { if {![catch {uplevel #0 [list source $tkfile]} msg]} { return } else { append errors "$tkfile: $msg $errorInfo " } } } set msg "Can't find a usable tk.tcl in the following directories: " append msg " $dirs " append msg "$errors " append msg "This probably means that Tk wasn't installed properly. " error $msg } tkInit/usr/csbmb/lib/tk8.0? @@@ hp&0X`[[\\\(\8h\Hp\Xx\h\x\\\\\\\\]]](]8]H]X]h]x]]]] ] @lmmm m0m@mPm`   v@@vXDvp, v8?vPv`Lv<vT?v4  dv(lv0hwH w$ 8@=Hhw dw0w@dwPP w`wxwX, www`,wwxh0x x8xPpDx`xxxxD xxxÀ$ xxxÈ$ÐyØyy y0y@à( èðø|yPyhy@yyy@yy8zzz(<z8zH  (4zXzhzx0Hzzz8Hzzz@xzHPXlz{{t`hpxpĀĈĐĘ M   0@P`p  h (08@HP8 8XP`p`h p 8xH`xƀƈƐƘƠƨưƸ  (\ 8Ph\x `(`(0d8Ph8dx@HP<X`hp xǀ$LjǐǘǠǨǰǸ( 40(8HXh0p@PG`@(`@ 0@ 0@ʘpʠȀ`ppʨʰʸ  8Ppۀ@HPX`h p x  ($8 H0,X(h4x<DLT\dlt|X`͈̀  8P`p͐͘͠ "$ͨ&Ͱ(*,.02͸468:<>@ B0D@FPH`JpLNPRTVXZ\^`bdfhj l8nHpXrhtv x(z|0~8@HPX`  x 0@P΀Έ`ΐpΘΠΨΰθP `< (8HX,h$ t  |0H`(|p08@HPx X`hp x< (@πT PhψTϐXϘX(@Ϡ\PhϨ\dϰϸ8$ @0@P(`xDaep`0x\@dр&шѐXPp&pp0Pјp&pPPaeTP(0LH`"@(@%P#'P)*+,0,-@-K Lae \((`)`80L8@DHHPPXtX`xhHh)ppx@Ҁ|.P)41@7<?EPGI`aeHL+0XU+@X VYP[p\0\]]aeLP T 8 XH\(,08`@HdPe, hgpkmuv`|@ww`w{P{r`tӠLӨPӰӸX\H  @04@0 D(08@HPaeHTLP/`/Pp@ ȘȨȸ0, 8,@H(8P0X`hpxՀՈHXhxՐ Ɉɘɨ՘T ՠըհոLHɸ< @0H`8$  (048@HPxʈʘXP`hpxXրֈ֐ְָ֘֠֨D(@׸( ae`xt( X8|(H038@pH03 0   P 0H`؀ pԈԠ؈ ԰ؐ ؘ 0ؠ`ب@ذP`pՀظՐh Pՠ (0հ8@HPX`0(@Xhpր֐pָ֠xـوِ٘t٠٨ٰٸ l(8HpXhxH׈טר׸  (08@|(8HXhH@PX`h8x؈ؘpبظxڀ(ڈڐژڠ @  8P(4 `xې04۠۸8X@XHPX`  0@h0 P`pp0x܀ۀܐۈېۘ۠ ܠܰۨ8 ۰۸0\H`x\ݐݠPݸT (|0D0@P8H`xސ@@HPX$ި޸` hpx܀܈ܐܘܠܨܸܰ <, (08@(8HHXhPX`hpxx߈ߘx H TH (8H Xhx ( 08@HdPX`h4 p80H`x,xހ0ވ( ސޘޠXިް޸<@ $ h (0@P08@HPD ]  p 0@Px߀`߈pߐ ߘߠߨ߰߸8 0<X@Xp,0(  (08$ 0@D @XpHDPHXL0`L@P`h|ppxlT aeL`DXp\PE@@d EP    p `        @ ʐ ($0, (h8 8Php8 xxh 4 4(80H XpTHL(@D ,(08X @HPX@hx`$h(p<(8Hx<`  0   p, ,0 4 8H8Xh<x@DH 8PL hPT T(8(0XHX8@\hxH` PX`d hpxh l l(@Xphpttx|(8HXhx %p T U ` Xp8   @  @ 0H `   0   P   p 0   P    p   ` 0 `  pxp vx }0 . X /0 3 Z@8@ 6@ 6 c 7 8 9 : e0   R n` T vp _P  ܰ ް  x@(`08@H=PX P` h,p9px j@ p x y ~ T @  ` P   uB  p `  5 5P ` P P p < @  ( 0 8#@ אH iP X ` h p x86 @ P08@HPX`hp(8HXhxx 0@ (08Phx@ @ ` p  `H*x111222 202@2P2` (08;8;H@;XHPX`XHPX`hpxBXBpBPV0BPYpBP\D_BPLBPeBPڠ BPr(BPO0D`8D@BPpHBPPDɠXBP`BP@hBPSpBPܠxBP0HPKM`PRUp^_`_P0PI8@HPX`hpxI8@SSSHPXT`hpxTT(T8TPT`TpTTT12%.12g080123456789abcdefX`hpxiHiXihixip  !`"@VVV@|` /usr/csbmb/lib/tcl8.0/usr/csbmb/libproc tclInit {} { global tcl_library tcl_version tcl_patchLevel env errorInfo global tcl_pkgPath rename tclInit {} set errors {} set dirs {} if [info exists env(TCL_LIBRARY)] { lappend dirs $env(TCL_LIBRARY) } lappend dirs [info library] set parentDir [file dirname [file dirname [info nameofexecutable]]] lappend dirs $parentDir/lib/tcl$tcl_version if [string match {*[ab]*} $tcl_patchLevel] { set lib tcl$tcl_patchLevel } else { set lib tcl$tcl_version } lappend dirs [file dirname $parentDir]/$lib/library lappend dirs $parentDir/library foreach i $dirs { set tcl_library $i set tclfile [file join $i init.tcl] if {[file exists $tclfile]} { lappend tcl_pkgPath [file dirname $i] if ![catch {uplevel #0 [list source $tclfile]} msg] { return } else { append errors "$tclfile: $msg $errorInfo " } } } set msg "Can't find a usable init.tcl in the following directories: " append msg " $dirs " append msg "$errors " append msg "This probably means that Tcl wasn't installed properly. " error $msg } tclInit (08;=X¸`hpx      (N'`<   8H`(08 @H PX ` h p x  < x    ,, hh    XX  X( X0 8 @ H P X` hp x  L .     \\ >      0 00  0(0 <8 x@ H P ,X h` h p x X     L    \    l 0    *.-,0)%$# "!+'&/*(gigigigigigigigigi gigigigigi gi gigigigigigigigigigigigigigigigigi'&%$#"!     gi     :/  ,    , :/    &"% !$ #' (' Ęŀ => Also See-> ; ǠXP@0ʸʰʠʘʈx` (vs. %s)Ǡ`8( װט׈xhXH8(ָ֨֘ֈxhXH0հՠՐՀph ظذبؠؘؐ؈؀xp  ؀      h`XPH@ @80( nvara XPH ݸݨݐ`@ ܨ܈h@۠xX8 ڰڐpP(ٰ٘ـ` ߨߠߘߐ߈߀xpߨphh``XXPHPHߨ߸߸߰߰߰߰߰`XPH@80( Display familiarity and polysemy information for the search string. The polysemy count is the number of senses in WordNet. Print all strings in the database containing the search string as an individual word, or as the first or last string in a word or collocation. Display the coordinates (sisters) of the search string. This search prints the immediate hypernym for each synset that contains the search string and the hypernym's immediate `hyponyms'. Hypernym is the generic term used to designate a whole class of specific instances. Y is a hypernym of X if X is a (kind of) Y. Hyponym is the generic term used to designate a member of a class. X is a hyponym of Y if X is a (kind of) Y. Coordinate words are words that have the same hypernym. Hypernym synsets are preceded by "->", and hyponym synsets are preceded by "=>". Display synonyms and immediate hypernyms of synsets containing the search string. Synsets are ordered by frequency of occurrence. Hypernym is the generic term used to designate a whole class of specific instances. Y is a hypernym of X if X is a (kind of) Y. Hypernym synsets are preceded by "=>". Display synonyms and immediate hypernyms of synsets containing the search string. Synsets are grouped by similarity of meaning. Hypernym is the generic term used to designate a whole class of specific instances. Y is a hypernym of X if X is a (kind of) Y. Hypernym synsets are preceded by "=>". Display synsets containing direct anotnyms of the search string. Direct antonyms are a pair of words between which there is an associative bond built up by co-occurrences. Antonym synsets are preceded by "=>". Recursively display hypernym (superordinate) tree for the search string. Hypernym is the generic term used to designate a whole class of specific instances. Y is a hypernym of X if X is a (kind of) Y. Hypernym synsets are preceded by "=>", and are indented from the left according to their level in the hierarchy. Display immediate hyponyms (subordinates) for the search string. Hyponym is the generic term used to designate a member of a class. X is a hyponym of Y if X is a (kind of) Y. Hyponym synsets are preceded by "=>". Display hyponym (subordinate) tree for the search string. This is a recursive search that finds the hyponyms of each hyponym. Hyponym is the generic term used to designate a member of a class. X is a hyponym of Y if X is a (kind of) Y. Hyponym synsets are preceded by "=>", and are indented from the left according to their level in the hierarchy. Display all holonyms of the search string. A holonym is the name of the whole of which the 'meronym' names a part. Y is a holonym of X if X is a part of Y. A meronym is the name of a constituent part, the substance of, or a member of something. X is a meronym of Y if X is a part of Y. Holonym synsets are preceded with either the string "MEMBER OF", "PART OF" or "SUBSTANCE OF" depending on the specific type of holonym. Display holonyms for search string tree. This is a recursive search that prints all the holonyms of the search string and all of the holonym's holonyms. A holonym is the name of the whole of which the meronym names a part. Y is a holonym of X if X is a part of Y. A meronym is the name of a constituent part, the substance of, or a member of something. X is a meronym of Y if X is a part of Y. Holonym synsets are preceded with either the string "MEMBER OF", "PART OF" or "SUBSTANCE OF" depending on the specific type of holonym. Synsets are indented from the left according to their level in the hierarchy. Display all meronyms of the search string. A meronym is the name of a constituent part, the substance of, or a member of something. X is a meronym of Y if X is a part of Y. A holonym is the name of the whole of which the meronym names a part. Y is a holonym of X if X is a part of Y. Meronym synsets are preceded with either the string "HAS MEMBER", "HAS PART" or "HAS SUBSTANCE" depending on the specific type of holonym. Display meronyms for search string tree. This is a recursive search the prints all the meronyms of the search string and all of its hypernyms. A meronym is the name of a constituent part, the substance of, or a member of something. X is a meronym of Y if X is a part of Y. A holonym is the name of the whole of which the meronym names a part. Y is a holonym of X if X is a part of Y. Hypernym is the generic term used to designate a whole class of specific instances. Y is a hypernym of X if X is a (kind of) Y. Meronym synsets are preceded with either the string "HAS MEMBER", "HAS PART" or "HAS SUBSTANCE" depending on the specific type of holonym. Synsets are indented from the left according to their level in the hierarchy. Display derived forms - nouns and verbs that are related morphologically. Each related synset is preceeded by its part of speech. Each word in the synset is followed by its sense number. Display domain to which this synset belongs. Each domain synset is preceeded by "CATEGORY", "REGION", or "USAGE" to distinguish topical, geographic and functional classifications, and it's part of speech. Each word is followed by its sense number. Display all synsets belonging to the domain. Each domain term synset is preceeded by "CATEGORY TERM", "REGION TERM", or "USAGE TERM" to distinguish topical, geographic and functional classes, and its part of speech. Each word is followed by its sense number. Display adjectives for which search string is an attribute. Display nouns that are attributes of search string. Display hyponym tree for the search string. This is a recursive search that finds the hyponyms of each hyponym. For verbs, hyponyms are refered to as troponyms. Troponyms indicate particular ways to perform a function. X is a hyponym of Y if to X is a particular way to Y. Troponym synsets are preceded by "=>", and are indented from the left according to their level in the hierarchy. Recursively display entailment relations of the search string. The action represented by the verb X entails Y if X cannot be done unless Y is, or has been, done. Entailment synsets are preceded by "=>", and are indented from the left according to their level in the hierarchy. Recursively display CAUSE TO relations of the search string. The action represented by the verb X causes the action represented by the verb Y. CAUSE TO synsets are preceded by "=>", and are indented from the left according to their level in the hierarch. Display applicable verb sentence frames for the search string. A frame is a sentence template illustrating the usage of a verb. Verb sentence frames are preceded with the string "*>" if a sentence frame is acceptable for all of the words in the synset, and with "=>" if a sentence frame is acceptable for the search string only. Some verb senses have example sentences. These are preceeded with "EX:". @~ hHhXHH}p}@~ `HH}p} HH}p}h@HH}p}(p     ǠҘ|ZZ8]|]^A\3r[od[S``ƴ[&Sܠ0`֠ڠHt^^Zd4`gV0 `F F[[h[4]}[aYp\eLJ4Z0^\l^<P_\\u[h\^\ɠ\O\[ _o@t<|tD_L #|{[dX'[$3l@L7<\8hp0]TO_^P&Z0SP\PZf^T[p+z^ְ{_8[4[QP)'0#@$hK8p`]][ `h[[] ^=\^U|_%X[+8] ^_&h`rZ_)] ]\fJfIx^Ut^OlZZZZ \5ZݠWPc[~8[o\X\\=[[s,[q[8^^K^^|^`1fmfG Z\j]X[1^^^jZL`e\OD`x^x^Y \O`x\K_T^^|_[[\M\Md`Lj[P_4_ <_^ ^D_[.^f[^[lHpZT^G_\}$\l^C(__a[<$_Q i`[fHlOL@C]]KDc0x( 4$XtǴ<,x4!h124+Tt78H1fh  `)< '$P(\hd8dJp?p@0APTp^PqruPvvwpxzp PP``00P 0 ` P"#&&'((p+`049<?ghP @  p0EIXPef`oPqtuv0vxxyy@z z}P  p@P0@PPP`Ӱ  P!$P&+0.39B0CFUVX\`ab@cdepen`p@r0txPz0~`p`PЀ`0 0%()*-..P2 3<=>?ApBVpWY[_ae y~@`` P p0 _@_P` `apa`@P`۰ & ' ) * 4 6 9` : ; <` < H  N O S S      ݰ 0 ޠ p   @  @ C  F G I I JP c dP e k  l mp o q  q0 q@ q xP zP @     @    p  @ p  0 @   p   0   p   @     @  @   0      ` !P $ )  , , - / 2 3 4 5 @ I J  M P Q U V0 Z a e  i@ j lP m n q` q r` r t  tp      P    @     @   p P ǐ   ΰ ` ϰ Р  @ Ґ @ ܠ ` P   @  0  `    p    p !@ > K `  Ɛ   @  0 `    ` 0 $  `  PA[@]0`a0aPa`bcgPhl`o p`tvpw~~0 P@`ϐPҀ#$ ' ( :`GI`LpMNOV0WYZ [[^behPklopsuwpx{P| |`|| P `p`@Pp@p p ` 000 p"$&`-p4556p@DPDGPRS@S`VX\_`j mnop0sv0PPp°Š `0p00Ҁ@$p0p6QS_`dfhg<rrt |$@ǜTlʰ8lҸ֘ 8,pt,TT  @@ @ '')*+-@0`5>FPFGJOO(O@OXV([]p^bpbdPdhdxdjjq(q@tuuvpwwxxxxxxxxxyyy,y0y4y8y<y@yDyHyzz{X{p{| %%%%%*(*,,@,D,H,L,P,T,X,\-116064686<:h:p;;@D@H@L@P@T@X@\QPQpQbellbinddestroyeventfocusfontgrabgridimageloweroptionpackplaceraisetktkwaitupdatewinfowmbuttoncanvasentryframelabellistboxmenumessagescaletext-name-sync-visual-use--activenormal".8.0sendargv%dargc-class-screenenvDISPLAY-use-visualTclTk"addclear clear"getr": ":normalboldromanitalicnormalmediumbooklightbolddemirionormalnarrowiso8859adobesun-family-size-weight-slantactualcreatedeletemeasuremetricsnames-ascent-fixedoptionfont%dmetricnamesfont "0itc ArialGenevaTimesMonacoCourierBookmanLightBookMediumDemiBoldObliqueItalic-Roman-\%03o"-format-from-shrink-to-zoomphoto-data-format-file-gamma1-height0-width0blank blank"cgetcopy"image "get get: putreadrbinarywrite, or or twoto fourthe "%dwhiteblack images*TimesMonacoCourierArialGenevafixedadobe{"} {01%dflatgrooveraisedridgesolidsunkenLabelButton#ecececBlackBlackBlackWhite-anchoranchorAnchorcenter#d9d9d9White-bd-bg-bitmapbitmapBitmap2commandCommand-cursorcursorCursordefaultDefault#a3a3a3-fg-fontfontFontBlackBlack-heightheightHeight0#d9d9d9Black01-imageimageImage1justifyJustifycenterValue0onValueValue1-padxpadXPad3m-padxpadXPad1-padypadYPad1m-padypadYPad1-reliefreliefReliefraised-reliefreliefReliefflat#b03060Black-statestateStatenormal0-texttextText-1-valuevalueValue-widthwidthWidth00cgetflashinvokeselecttogglegray50createimage%ddeleteimage "height%dnames names"typetypes types"widthcenternneesesswwnwbevelmiterroundbuttleftright"ControlShiftLockMetaMAltB1Button1B2Button2B3Button3B4Button4B5Button5Mod1M1CommandMod2M2OptionMod3M3Mod4M4Mod5M5DoubleTripleAnyKeyButtonMotionEnterLeaveFocusInExposeDestroyUnmapMapGravity%s %s??0x%x%d.%dadddeleteinfo<<>>"-whennowheadmarktail-above-button-count-detail-focus-height-keysym-mode-place-root-rootx-rooty-serial-state-time-width-window-x-y<Triple-Double-->gray50""_tk%derrorgray75gray50gray25gray12infowarning%x%x send #%d-async-- "c-n %x %d-r -s _commCommr-s -i -e -c %dPRIMARYARCATOMBITMAPCURSORFONTINTEGERPIXMAPPOINTSTRINGWINDOWWM_NAMEWEIGHTNOTICE-globalcurrentreleasesetstatusnonegloballocalwmmenubartracingonoffaspectclient0x%lxcommandpassiveactiveframe0x%xgridgroupiconify%d %dmaxsizeminsize10userprogramstateiconnormaliconictitle"appnamescalingcellsclassdepthheightidmanagernameparentrootxrootyscreenservervisualvrootxvrootywidthxyatominterpsexistsfpixelspixelsrgball"optionwindow0x%x%d %d%d.unknown%s %d 0x%xgridbboxforgetremoveinfo-in%d %d01sizeslaves-column-row : "%d-weight-pad-ipadx-ipady-padx-pady-sticky{}bestdefault", new-force"all0x%xXXXpacktopbottomleftrightafterappendbeforeforgetinfo-in-anchor10 -fill nonexyboth -side slavesunpacktopbottomleftrightexpandfillfillxfillypadxpadyframe-after-before-expand-fill-ipadx-ipady-padx-pady-side-bitmap0-font0-image1-label-menu01-statenormal-value-1#ecececBlack2BlackWhite#d9d9d9White-bd-bg2-cursorcursorCursorarrow#a3a3a3-fg-fontfontFontBlackCommand-reliefreliefReliefraised#b03060Black0tearOffTearOff1-titletitleTitle-typetypeTypenormal-typemenubarMenu-menunormaladdcgetclonedeleteindexnone%dinsertinvokeposttypecommandcascadetearoffunpostactivelastend"0.-cursortkMenusgray50 unpost post %d %dW.helpM#d9d9d9White-bd-bg2-cursorcursorCursorxterm1-fg-fontfontFontBlack-heightheightHeight24#d9d9d9Black1Black00OffTime300OnTime6002-padxpadXPad1-padypadYPad1-reliefreliefReliefsunken#c3c3c3Black10BlackWhitesetGridSetGrid0Spacing0Spacing0Spacing0-statestateStatenormal-tabstabsTabs-widthwidthWidth80-wrapwrapWrapcharcharnonenormalwordselraisedcurrentinsertTextbboxcgetcompare10debugdeletegetindexdumpimagemarkscansearchseetagwindowxviewyview-count-exact-nocase-regexp--%dleftrightcenternumeric-all-text-tag-mark-image-windowUsage: endtexttagontagoff%d.%d borderseofdragtomark%g %g %g %g 0markmarkgravity"rightleftnamesnextsetunsetfirstlast"end%d.%dcharslineslineendwordendtextwindow-aligncenter-create-padx0-pady00-windowcget"createnames in bottomcentertop??image-aligncenter-padx0-pady0-image-namecget"createnames#%dbottomcentertop??0-font-offset-relief-tabs-wrapadd tag bindcgetdeletelowernamesraiserangesremovetag "currentPPM"%d": wP6 P5 0moveto scrollpagesunitsbad , " for append-format-type"clear_clipclear"get-typehandle-formatownINCRTARGETSTEXT0x%x %s0x%x"arrowboatcircleclockcrossdotdotboxfleurgobblergumbyhand1hand2hearticonmanmousepencilpirateplusshuttlesizingspiderstartargettcrosstop_teetrekwatchxterm"cursor#d9d9d9White-bd-bg01confineConfine1-cursorcursorCursor-heightheightHeight7c#d9d9d9Black1Black00OffTime300OnTime6002-reliefreliefReliefflat#c3c3c3Black10BlackWhite-widthwidthWidth10c00Canvasaddtagbboxbinditem "canvasxcanvasycgetcoordscreate"%ddcharsdeletedtagfind findfocusgettagsicursorindexinsertlowertag "moveraisescalescanmarkdragtoselectadjustclearfromitemtotypexviewyviewallcurrentabove allbelowclosestwithtag%g %g -fillblack-tags-width1oval clip fill stroke -anchorcenter-height0-tags-width0-windowwindowcanvas -arrownone8 10 3butt-fillblackround-smooth012-tags-width1linenonefirstlastbothstroke clip fill -anchorcenter-image-tagsimage -anchorcenter-fillblack-fontleft-tags-text-width0text endinsert"00.51falsetrue-file-height-pagex-pagey-rotate-width-x-ygraycolorwUnknown%%For: save gsave ": ""%d/Symbol<%02x>%d %d r":-anchorcenter-bitmapblack-tagsbitmap fill #d9d9d9White-bd-bg0-classclassClassFrame-classclassClass0-cursorcursorCursor-heightheightHeight0#d9d9d9Black0-menumenuMenu-reliefreliefReliefflat-screenscreenScreen0-useuseUse-visualvisualVisual-widthwidthWidth0-class-screen-use-visualclassClassFrameuseUsevisualVisualcgetplaceforgetinfo-x %d -y %d -in slaves-anchorignoreinsideoutside-height-in-relx-rely-width-x-y-help"for " :%d%g-extent90-fillblack-start0-style-tags-width1arcarcchord clip fill stroke #ecececBlack#d9d9d9White0-bd-bg2commandCommand-cursorcursorCursor-digitsdigitsDigits0-fg-fontfontFontBlackBlack-fromfromFrom0#d9d9d9Black1-labellabelLabel-lengthlengthLength100-orientorientOrient-reliefreliefReliefflat3001001130raised-statestateStatenormal0-totoTo100#c3c3c3White-widthwidthWidth15Scalecgetcoords%d %dgettrough1slidertrough2set%%.%df%%.%de X%dR%d %denvDISPLAY#ecececBlackBlackWhite-anchoranchorAnchorcenter#d9d9d9White-bd-bg-bitmapbitmapBitmap2-cursorcursorCursorbelow#a3a3a3-fg-fontfontFontBlack-heightheightHeight0#d9d9d9Black0-imageimageImage0justifyJustifycenter-menumenuMenu-padxpadXPad4p-padypadYPad3p-reliefreliefReliefflat-statestateStatenormal0-texttextText-1-widthwidthWidth00abovebelowleftrightflushcgetgray500-anchoranchorAnchorcenter-aspectaspectAspect150#d9d9d9White-bd-bg2-cursorcursorCursor-fg-fontfontFontBlack#d9d9d9Black0justifyJustifyleft-padxpadXPad-1-padypadYPad-1-reliefreliefReliefflat0-texttextText-widthwidthWidth0Messagecget#d9d9d9White-bd-bg2-cursorcursorCursor1-fg-fontfontFontBlack-heightheightHeight10#d9d9d9Black1-reliefreliefReliefsunken#c3c3c3Black1BlackWhitebrowsesetGridSetGrid0-widthwidthWidth20Listboxbboxcget%ddeletegetindexinsertnearestscanmarkdragtoseeanchorclear10setsize size"xview0 1%g %gyviewactiveend %g %g-fillblack-smooth012-tags-width1polygoneoclip eofill stroke bitmap-data-file#000000")r": _width_height_x_hot_y_hotcharcget#ecececBlackReliefraised#d9d9d9White-bd-bg2commandCommand-cursorcursorCursor-1#d9d9d9Black1-jumpjumpJump0-orientorientOrient-reliefreliefReliefsunken300100#c3c3c3White-widthwidthWidth15arrow1sliderarrow2cgetdelta%gget get" trough1trough2set-fileargv%dargcargv010 stdout% stderrGIF"GIF87aGIF89a#d9d9d9White-bd-bg2-cursorcursorCursorxterm1-fg-fontfontFontBlack#d9d9d9Black1Black00OffTime300OnTime6002justifyJustifyleft-reliefreliefReliefsunken#c3c3c3Black10BlackWhite-showshowShow-statestateStatenormal-widthwidthWidth20Entrybboxcgetdeleteget get"icursorindex%dinsertscanmarkdragtoclearpresent01adjustfromrangetoxview%g %ganchor"end %g %glistontclIOstdinstdoutstderr" -, or -01linenonefull%cautocrcrlflfbinarytcpinforeadwriteeofblockedsaw_cr%dmodenameopentypeadddeletelist": booleandoubleintyesnotruefalseonoffARITHfilettytcp-modemodenoems": file%d%dsock%dlinenoneauto"pipewr"RDONLYWRONLYRDWRAPPENDCREATEXCLNOCTTYTRUNC": rPOSIXcancelidleinfooption?id?event "idletimerafter#anymoreexistsgetnamessetsize::readsetunsettraceoptions-1-s--"accessdefinecan't "()": appendarraybinarybreakcasecatchclockconcaterrorevalexitexprfcopyforforeachformatglobalifincrinfointerpjoinlappendlindexlinsertlistllengthloadlrangelsearchlsortpackageprocregexpregsubrenamereturnscansetsplitstringsubstswitchtraceunsetuplevelupvarwhileaftercdcloseeoffileflushgetsglobopenpidputspwdreadseeksockettelltimeupdatevwaitexecsource8.0Tcl::"deleterenamecan't "COREIDELETE ...unknown ...%ld0NONEdonepush1push4popdupconcat1evalStkexprStkloadStkincrStkjump1jump4lorlandbitorbitxorbitandeqneqltgtlegelshiftrshiftaddsubmultdivmoduplusuminusbitnotnotbreak, array, link, arg, temp loopcatch %d%u # %u """\"\f\n\r\t\v%c ......$0 thenelseifelse-sizestdout ": or "startcurrentend--r -server-myaddr-myporttcp-asyncswitch///./:::/\:HOMEuser "--\[]*?{} "s " "},*[]?\\.atimecopydeletedirnameexistsisfilejoinlstatmtimemkdirownedrenamesizesplitstattailtypevolumes"indefaultdirName~ optionvolumes:.": %lddevinomodenlinkuidgid%lusizeatimemtimectimetypefilefifolinksocketunknowncomparefirstindexlastlengthmatchrangetolowertouppertrimwordend-exact-glob-regexp--{"-nocase--0-1 -1%d %d1-all-codeokerrorreturnbreak%u optionstring defaultvdeletevinfo} { r w u|^&==!=<><=>=<<>>+-*/%+-~!acosasinatanatan2ceilcoscoshexpfloorfmodhypotloglog10powsinsinhsqrttantanhabsdoubleintrandroundsrandcmdName%d: %d COREIDELETEunknown"%s "%.*s" ARITHDIVZERO...DOMAINUNKNOWNnsNamecodecurrentdeleteevalexportforgetimportinscopeoriginparenttailwhich"::optionarginscope-clear-forcename?name?string"ARITHyesnotruefalseonoffargsbodydefaultexistsglobalslevellibraryloadedlocalsprocsscriptvars-exact-glob-regexp-ascii-index-realthenelseifelseoption"commandvarNameaccess.so list%d": PATH/.": , then {} -exact, need forgetnames names"providerequire-exactunknown""file "tclLoad_Initno {} { {{}%%.%dg%ldendformatscanoption"binaryaliasaliasescreatedeleteevalexistsexposehidehiddenissafeslavessharetargetaliasaliasesevalexposehidehiddenissafeenvosmachine0-safe--" {}"?path?-globalpathalias "optionunknownpipefile%d%ld10NULL??bgerror name""::...args" to " NONEindexbad ", or , "$ copyingerror ": "" to "": "-force--option-group-owner/...": %0#5lowritingreadingwriteread file "": %ld%d E2BIGEACCESEADVEAGAINEBADEEBADFEBADFDEBADMSGEBADREBADRQCEBADSLTEBFONTEBUSYECHILDECHRNGECOMMEDEADLKEDOMEDQUOTEEXISTEFAULTEFBIGEIDRMEINITEINTREINVALEIOEISCONNEISDIREL2HLTEL3HLTEL3RSTELIBACCELIBBADELIBMAXELIBSCNELNRNGELOOPEMFILEEMLINKENAVAILENFILEENOANOENOBUFSENOCSIENODATAENODEVENOENTENOEXECENOLCKENOLINKENOMEMENOMSGENONETENOPKGENOSPCENOSRENOSTRENOSYSENOTBLKENOTDIRENOTNAMENOTSUPENOTTYENXIOEPERMEPIPEEPROTOERANGEEREMCHGEREMDEVEREMOTEEROFSESPIPEESRCHESRMNTESTALEETIMEETXTBSYEUCLEANEUNATCHEUSERSEXDEVEXFULLSIGABRTSIGALRMSIGBUSSIGCHLDSIGCONTSIGEMTSIGFPESIGHUPSIGILLSIGINTSIGIOSIGKILLSIGPIPESIGPROFSIGPWRSIGQUITSIGSEGVSIGSTOPSIGSYSSIGTERMSIGTRAPSIGTSTPSIGTTINSIGTTOUSIGURGSIGUSR1SIGUSR2SIGXCPUSIGXFSZhangupstopstringenvhistoryadd"01ARITHclicksformatscanseconds-format-gmt-base-gmtoptionswitch"januarymarchaprilmayjunejulyaugustseptoctobersundaymondaytuesdaytueswednesthurthursfridayyearmonthweekdayhourminuteminsecondsectodaynowlastthisnextagoepochgmtututcwetbstwatatnftnstndtastadtestedtcstcdtmstmdtpstpdtystydthsthdtcatahstntidlwcetmetmewtmestswtsstfwtfsteetbtitzp4zp5istzp6wastwadtjtcctjstcastcadteasteadtgstnztnzstnzdtidledstabcdefghiklmnopqrstuvwxyzama.m.pmp.m.?ȓ1.  @p?@@ozH@9ffffff@R??@`@$?֓>>F)>Y9?333333?Q?(\)??Ghy =|׽@?`A7K?-?XbM?O;dZ@ !TD-?!TD-!TD-!TD- !TD-@!TD-?PbM@@@s @x@Zjլ@o@ AG8?AA @@  x> Ё D Ё  D  : & d G ,  ̂  l   ଂ &  ߬  d  $  ؂ g 0  6????EAfXe`i P    Ұ =Ѓ Ϡ E(=Ё Z=ЋE!) P a Ɛ = Ő } Ð ;   D ! % p #  @ O      0  Ѓ  K   p  a p JaK W  7 g ` g l  P l l  l l   l  Ѓ u010 0  Y`e: 2 P Ѓ{@4@0e#:`Ђ @ ! ~ '  }Ѓ T8@  q `` q  @< o 8 n h= l E j  e ! e 8 d@ YG{ \  \ f Z ) Z  X  U@  Rp ' D0 O_ > 2 =P  @  < `+4N`;``@4 a%*   !"(R%/  @@-600@  ]P601$0@  I  $  $@  Qw!!"  @  0 p   $ 4f 렂 / 460 p A P  ! ؀  , א PЁ MPPЃ  Ѓ  ] P O!Y0.OY0 @ B_ a&a _ k!k m p _ m [ @ d` p 5 D  p | p & /p? 0 9 @  P p P 0 P P:@. y:)i5'  ~ J``. {  { L z` 1 y F w  v  vp  vP  l 9 k = j ; i 7 hЃ : g  f % f`  d & c \ b  a \ `@  _ \ ^p  ^ / ]`  [@  X0  W - W0 + V &P U Š`P TP  T % Sp N Q   Q 5 P H O  >  M  7 L  l J   JP  IP \ G X`c00!00p00 0@ 0'80e  Z  A ( Ё   `    `    P    P k/ p K/  $ p $ Є C 99 9(933 93 ߀ CA ې 2C ڐ - Ѓ 5 D LCa  EЁIpoGIpIpIpLPMpq0NpIpq0aLP Ő eEЛEЁGMpInpMa'pNp] EЃNpMp6b& ` P?npo . @ EЃIpMpq0 P N +t0 0 Ht0V 0 * < ) H ` 2    * `   *   0 #  % p      @ pp0p  p  p @ 000 0@   o@ ( Ђ P ` @  z   H x j vp  u Ѓ   u Ѓ  u0  t  t0 - sp < rp = qp I q np - m 6  l0 1 Ё           *!0  i@  h X 6  + eЅ ) e  p6   p    Ё !0 F   !0  ]!0 l o [ !0 / K  . @  8   >  $` P P I !   J ?B hp P G qP    X        % @       ^  a  P  0 p ~!0 @ i!0 P d !0  [ # % F% (  !0 `   Ѓ    !   5.` - o  2.` - . . 쀃 . 렄  P O 5Ё ` b \ `    p 3 ٠ @ ؠ f d `   [Kp &K K &Kp K " n ` i0 i0  P E ' `A`$$,Ѓ$$$$O$ $:$"`$$ $E`$7$P`$=9L$i$`$ $ @ `$ $ z  $$$$$Z$^`$ 0$/Ђ$Ђ$$`$ \p ' [Ѓ .`$`$$`$$`$Ӏ$1$3`$q$$ $1 $$$6$$<$l$ F  <  : I 9 - 8Ѓ D$$$$ 4 L$"$H$$$'`$+$`$- - E , V$- * `$$ * $2 $0 ' . ' *p$0$$ % 0$ % @$$P$ #Є 0#$ # EP$:  ` 3  * Ѓ  @  Ђ v  $$#P$$$$P$[$$#P$Ђ$$Ђ$$ЃЅЂ$$[ $ $ P$D$$~ $L$`$L$R$ P   &$ $ $$$$a$$$$($$$  86[$$CMЃ$RP$fЂ$P$2 @ MЃ$>U$l$6_$gw$PfЁ$9_$u p wP$KK0$2 Ѐ )G0$D Ѓ Jd$=$ LP$"[Ѕ[Ё$DK0$J$d$d$GP$7n$P$fЃ$P$2 lЁ$7 [Ђ$P$K0$fЂ$P$ >d$ 6 fЁ$P$n$(  0 !fЄ$MЈ$Cn$. `   t$ p % Ѓ  ` ,K0$B p + 5 ' 0  P   ( P  ( ( .`( /  `(  `( (.  ( 0 [ +(T ( P ( (W ` /  1((> wP Z@((P(&p(І(p(B r 3(((((} l  0ˀ((p(Р(ð(U gЃ ð(t(Ր(P(( W 0( QЃ Q P _ (Ԁ( N  I`  FP 1 E Ԁ( Ԁ( 9 p(p(((((((S *0 3 )` (`(`(hO@(R(((O@(1()@(('((("(((G (  "5((=((1(P>P( `( (`(h @(@((`( #@((l`( (4)(`( (@(&)())#)(@()(`(((#(+(> Ѓ 2(@(`( ` (W=(`(((?((R`( (B0>P(.((()(0(`( ` 0(`( Ђ (g  (@( ` (@(@ 0 T0($JMMM@((((eT0( mT0(  T0( P T0(T0T0(NJT0(J(%T0(.T0(T0(S(T0(T0(+T0(S( ` K 0 W (W (X0(C [ (h\ ('\ (,t 0 [ (\ (,?, p l W ` A @ [ (\ ( \ (  [ (*i (\ +([ (\ (\ ( l (m m (r Ѓ  `  r Ђ }P(}P(n 0 J,,X0@,,( 8 6  3 i (  .i (i ( i ( ` M ,?p, | p zP " y , yP 2 x`  t , s \ q Y p ^0@,, h  g  d < c  ^  ,1 ,@,@, U@ C T0  S . S  R @,,1 Q @,, P ΰ,,,@, M  M ,Q KP ,F I  I $ H ,1,ᐅ, ? C >  > 5 =0 ',Ѓ,) ;  ;0 ,' :@ H 9 $ 8p  8 ,,,C,,,0,, ,&,.,H,  s Ђ ,   Є : , , , , ` , @  0       @   밂 g  V 谂 1 F2, 怂 /,_2,  ݀ "1P,1, p Z,B Z, ^Ђ,M ؐ E ׀  0 ^Є,YЅ,OZ, Ð Z,)^Ђ,%  H ) 0  ]  0 E 0 i,C u,S jK,r,r,x,) i,u,+up,ltЂ, x,L up, P W0 0 1 n  ` L  ! Ơ00kЅ0P0p000. 0 00P000谆0)ɰˠ00P0}0ɰ00ɰ0ˠ000Eɰ0+ɰ0ˠ0!ɰ0谆06ɰ0ˠ0Fɰ0ˠ0gɰˠ00ɰ0ˠ09ɰ0ˠ0006ɰ0ˠ0.ɰ0ˠ0ɰ0ˠ0vɰ0ˠ0C0zɰ0(ɰ0K0Kɰ00ˠ0=00t _ 0T00 \ 5 [ `0xP0 V0 30000?00 S`  S ,0 R / 0 Q0  0ɰ0p0ˠ0ɰ0p0p0pɰ0ˠ0p000op0Aɰ0p0ɰ0ˠ0D ? `` 0`0`0`0 0 0`0;0$ 0 0p0 0 5Ѓ 0000000S0 2  2 s谂0-谆0谄0 ,0 S0p0 *0 DP07 (@ QP0 &  $ z " S !0  Ё G  d 0 P0  P0 @    p  P   r l d +  Q     Ђ     M @%P0'P0  0(0) =- 0(0- 0 - 0x Y @ V Ѓ (0 0 (0 (0)0 @ - 0 밂 Q1@04070@ h80YMP08 倂 wMPMPMP0806 P  0  p   u @ J80MP08 Р a80 b @  @ T`0T`0N ?X 0YP0 @ 0Y0' #^@0Y0  3 Ѓ M p Y0  Y0 Y0#Y 2 3    0   NhІ0k0 0l0* 0 nll0< `   Ol0" [l0   & l0 l0 P  "  44 M  P  I  0  }` @44 { 04' zP 44 y  v d u M s 4 s` 4 s  m m m` Љ44(044`4^ fP z4 a 4 _ N ]Ђ D044`4P4 4 [0 Z * Y Y  4p4 4p400440Z4M44h000444A0V F  A $444 @@ 04 ? 4 ?0 044 >P 4 2Ѓ U됅4 42 0` D@47 .p z@4$ + Q4 'Ђ  $  ` 484 4 4444 4 4 0 @4  @4 Ѓ4 Ѕ4' Ѓ4 Ѕ4T 0  P P&44D$444  4 (@47(@4!(@48 p43@43 *" 4  )4'" 4 p ' . (@4= @ -.4.4.4343434[ G*@4_/@4   ࠃ Q ` ; ` / ݠ  ܰ +@PLp448JP4C4E ٰ PC4D @ L4GL4GN@44L4v  ϰ dB4 ͐ @ FL4 0  @  Ѓ Xpd044+b04[40 &[4} d4$d45d4]4 #^4`4 p j Ђ 7`4[ 4(`4 Є +^4d4`4 hЋ84:`88 88 P 08@88@8@808A8@88@8@888@8@808`* 8208@880898088281 Ѓ ]  08 8 -88 888888 8P80480888888 0 8PP8"85088t808 @ V ~Ѓ 8P8 { *8 { * z w x` ;888, v oЁ8S r ZЁ8 q } o0 d m z k S jP s hp Ё8 g Ё8 gP  e `@888ʐ8l`8 ^ P888Y8 U $8t S@ `8) R0 W P O Op 1 N & N +P`88%`8= K `8 >@ b <

p8%p8;08 5+8;8 ` <Ё828h28+8;8280++8;8 0 >p8&8!8>p8;8+8;8 䐄 +8;8;8;;08 ߰ 4 Ѓ ;8&8M;8+ P =8;8=8=8;8 28?8   Xp8 p Xp85 ` Xp78 Xp8 0 Xp8 ϰ Xp8 ` N      F  ^hЅ8. 0 @<| Ё<j8? p g87 g8/g( Tf8/ Zq82s8Ivr8q8v8rr<p<_ j8)<0s8 {P87s8s8Fs8s8G sss82q8s8q8 < ,< <( <%<*  <# `<<. P `< <.  a }p !s86p<8s8T y s8 w` 5 v o t s8 m s8c 8<u@<% bP s8,<,< ` << _Ђ  <! ^ ><$@<3@<# [ p< [ C <bp< X  I` m@<@<]@<S A c 8c 8)Ђ<c 8k<{P8߰<߰<1<9<\߰<߰<߰< :P Ё<c ߰<8߰<G 7 << 7 ! < 6 > < 5  < 50 4 4p 40 U 2Ѓ 2P K 1  0 00 / /p % . < .` .@  )P ( (` ( ' 0< & &Ђ  $ ! $0 # # < " "  @  P  p < Є ; Ѓ )   @ 5 `  # ` <@< P %@<<<<<8<<Ё<&< Ђ _<t p A ` o  P<, Ђ  P<" "  p @<@@< <; Ѓ ; << Y r   p   퀁 ` "10<<-< p 10<< U0<- < p 8 01<  0<0 "- < p ? ` ; p Q><4?<D>3==<?p<>&><=<?=1><?p> ۀ Y  ><= 0 @@@E@@@@@"@@*@p@   '`@@@Ё@Z ɀ `@@@  "@Ё@@``@@@p@ P J  Ѓ   /@``@@Ё@@ @-Ё@`@@@V !@Ё@@@@(@p@`@K ` 0 _ [ 0 S@Ё@`@.p@`@ P ( P CЁ@ C N @ ^  Ђ @'@+@@Ё@l@i P @*@ @  G @} @ &@ z0 #`@b`@i vp ``@@p@`@@ oP o N`@ m r`@ k $ k V@@`@ i  eP - d 3 c @ b 2 a % a@ `  ]p @@ ] A \ r@ Y  W` q U r S S Rp  O  L ) KP ) J JP 8 I` H I G Gp j E  AP z ?` ~ =` t ; 9 : 9 9 B 8  6 5 5`  /0  ,  ' & , % % p #Ђ - " " "  `   z @ n     @ 3 P 9  0@@K D6G0@)0D7 @G0@>7 @ `  ΀ 0D0D @ DO DD ΰD8D/D0Dj P DM Ђ DDΰDDX4P@ΰD& DDΰD+DDD(DDD DD*ΰDD0D{PDD4P@D'0D m 3  D"DbD[D9sb D94P@?D0!D~4P@>D w DDΰD24P@4P@h0D k DDD*DDDID@DM4P@G0@4P4P@ W  U@ "P2D Sp D J N H ( H GЂ B F  Bp  > l =  :  50  2 5 1 A 0  - : ,  ( [ '@  $ HD. # F ! D !p DD D   P yD @ cDD `    DDD DD 0  D D DR 5ЃD2 Ѓ  ЁD  a$@$@DD` @ Ѓ  0 \ 䰃 7 ` Z ဃ L @ 2 p   NpDNpD}R DR DD @  0   -   . `   %      zp  t } r XPH'PHuPHnPH l  i  g0 ЁH f  fP * e '6H(ЁH?@H=H<ЁHe<ЁH<ЁH7<ЁH<ЁHZ<ЁH<ЁHE<ЁH<ЁHW@H?@H װ  `  Ѱ  ΀ y ̠  P \  Đ PH y Ѓ Z `   P `   Z P 4 `  BlH   O vwHH P =wH- wH @  0 @  1 Q Ѓ S  P 0LЁLL0LLPL@LЁLLLL0L@LLLLLL wP lH v  v O u0 3 tP  q  op q m  k LLLL&LL".ЂLL ЁL L°LL=LL L&ЃL`L L1ЂL0L(@!@L@L@LЁL°L°LЁL LЁL LЁL LЁL LЁL LЁL LLЁL LЁL L°LОЁLLLЁLЁLЁLLL'ЁLLUL$ЁLLL" L W >pLpLpLcƠL!L'ƠƠLƠL[LƠLqƠLL K  K L K  K ΀L Jp - I 7΀L H 9΀L G c΀L EЃ ΀L E ΀L E +΀L D@ ΀L A e΀L @  =P } ;P 0`LLLLpL蠁L`LLLLLLLLL0LLpLLL  s  b   `   + 0 ~ 0    0 L@L7@LpLppLpL Ѓ   0 - p <0L P L 0  :L<L9 <L:LF:L  ;LV;L;L;Ls;L;<L:L<L<;L<L ߠ  P KL+K@LD P VK@LKL Р u  `   ͐ DL L @ E A  Ђ 7   ] P    r  P    * C `  rPrPLB 0 rPrPL P z ` | % ,   @ "   L (  3 l   ` 5 u 6 ? I \ OP`P2`Pm``Ps``P0P0`P`P o PW n@ `PP0PM PP PXPЄPPݰPj Pk P P* PSݰPPP' P. P P P P_ P PP* PR Po P P~ఁP' P P : ^ P= @ 7 8ЌpPPP0PŀPĐPpPʠPЁPPЁP`P0PP PP+ PPPP %p 06PP谁P送PPPPPPPP ! # !  0 M  E Ѓ L  P0P  P Ѓ  P   @ P  P 0 y @ Y Ѓ  p & Ѓ P  '   p p0P0PP0P C p S F \    I p  u  ,P'P" 'P'P 'P,P @ ,P'P*,P,Pi,P,P,P\ 쐃 t/P3P P  P /P 倃  % 䀃  0 % 㐁  p 8P8P& U EO@PP 0 h ׀ o հ EP 0 EP  p OP' OPJ p * Ȱ  0  ) P !  Ơ    p  0 h "  O  3 @ DgohPPe0P[g3PQe0P  hP hP 0   ?  ppP Ђ ppPPT*yОP>TyЃP+ `  ` PT  % ` 7TTTaT?  Ѓ  P  TT + TTTJ %T b @ U U 5 e ] ~ 1 }  z ! y 7 y  u TT`T g x e  a  WP O V m T` @ SP  S C Q @T$ P @T, O @GT= M0  M  LЃ  Lp  K  K  J  J ' J@ ЁTT׀TT@TT I , HЂ %p0TT GЃ + G  D T. C TJ㰁T3 B +㰁T =0 㰁T/ 6Ѓ  6 TA 1p U 00 T -d  -( J + ! +`  +  *  *`  *  )܁  ) H (` = '` L0T %Ђ T\T- # ? " TT! ! T& Ѓ  `   3 P o  T P >+pT1pT3 T+pTpT"+pTpTHTD+pTT+pTI+pTT+pT+pTT#0T+pT0T#PT+pTPT#ЃT+pTЂT+p0T +pT0T!+p+p+p?T+pTT+p0T+pT0T+p T+pT T"+p+p4+p+p"`T+pT T+pT&T+pTpT+p+pT+pT%pT%+p+pT3+pT @ ] >T@PTET'AT5ETHTOH JATFTF03T ` @@N TTcN T@@T 0 2 d   8 Ă ̃X  t b ) T TX"XX܆X܇XtT܆X܂X܆X$XtT( p TX XX܇XtT$XzT( < TX-X2Xk܄X& @ TX XX&܄XX܇X! TX XX܇XtTtTtT$XPX+ , ܃XtTTXPX X<X>܆X܇XX$ @ <X<X | 5X  XX<X<X<X<X Ԃ +܄X<X < 4<X  p<XTX @ hXTXXX 0ȄX 8 70X Ђ " D  +XtT<XXtT<X% &ȃXāX%X(<XMXzTXtTtTtTtTtTԃXԃX,XXtTtTtTtT,XXX|ăTtTTXjTXTX<X0 w  t܂ o$X5 r8 !<XS܄X n tT m ?HXHX7 k $܃X܄X܄X$ j$  iĂ 3 h܂ " hd F g4 H f$ 6XX&<X c 2lXlXX&<X ap XDlX _ FXb \ā ) \ XX܇X [ <X Z <X<X<X<X<X Y  Y` X Xt HXX W a V@  Rd + Q  Q@  P  P  P - OP / N 0 M܂  K` ! Jȁ ) J,  I  I8  HԂ c GH  D * CȂ  Ch ] A & AL  @ D ? A >ȁ 2 =  =ԁ  = ! = & <  :d  6Ԃ 0 6 ߜXL 4 ߜXD 3 紁X 2 紁X 2L i 0 $X)ԂXXXX& , X8X8X+X* )Ȃ - ) 8X- (, ; ' ~ %@ DX0Xe !  !@  Ԃ <   dXy,X |   , x XXXXX  X2  *`XX`X  @`X`X`X`X`X`X`X`X`X`X T      \   " t  0 XXpX`XpXN  Z  (̐| T  < H,,,hh(<Đ2P8,ȉșȍ P ԃ,t88 ćؓ TЄ@.xԅ؃,pT Lؒܧ̆|Pt̏̍̍̍̍ |,Xtx.@D4Є4Є(̾T80<h<<,9v̈̒̋999999< <Ć,[\ ,\ d,,]SYPfS؈fp\\PDUDDc0c0c0]c0d\ \ \ [f[fYPUgtTX$,|܇XXT$X,`,XX|܇̄|X|̃$t0X|4̃$|Љ|ЃuPuP,t0̆|t,`hTTTDDDDDDDDTTDTTDDTTT̲HPHP|܆,TЉ|И|̐|̅̅Ȅ|T,ldЉ|܈|܍,,xxxx4ȉpPЇPPPhxTЌ|T|lאtpDאDDאЍ|DאאD00 ې  $Ԑ(,,І  0t048t܇ԇp<ԄېD4Hdddԧ䐃xﰇЄtH Ѓh\\hאЊאЊp xԃpאא`n̆TTĢTTTTċ̆̆tdTȄ̐llllllllllll̊@Ĥllph& ppDhHhH@p`d`d`,& pp&,,,,...$БȌ$ 40Ȇ,,,,,،,,,,,t8Ј,8Ѝ:hhȐ Ȉ̈( ȕ,:$Ї>EMPtІMR`R`R`MR`LЍІHLЅHLT@U@U@U@U@Ѓԍ_@D_8D8ăD888hЇh@HhhĨ$8$Ȉ`4D`4܉Ďȋ8(((,^P܆888$D`$ȃ8`p2~DDD~~~$$@PT<fXЋ\ȑttt㰄tP  t`   $tX`܊܉l܉l| $ АĠ Њptt㰄ܑpؐؗDDDDDDDDDDDDDDDD4DDDD4D|DDD44DDD؏ DD4d4ؒ4d؋,pT||l,TTX\`d PHHHHHHHH,tzthlt0Ȉ̃p|t(,xttp"tȆpptpttttH,ąp,ă,ă,ă,ă,Ą,ă,Ą,Ą,ă,ą|.DxDȄȉ؈DtȔ̇TD`pD`@`ȉ> `.`؏D@@ p`;`D.<tt DD@`t`ȇ((<x``tp;`DDȘxxȍ@@ DD((ȋ؄̃``> H؄>@A ȅ̌A B@D` ܏@؋܎ DDDtt tR`\؈؈ؐ؈؇؅؏]ltlm0n`k ]n`lm0k lm0k 4$ ]$ $ tm0ldo0  $ $   $   $ $$$$$$(]D  ܈0q(DD D D Dt  y@ڀXРē؉ȃ ϠϠtЍЇРH܇ ̍ЃشԋϠȋȃРЛȋ,РȈ`РؑȍTHȊ|؋ ܉Р\،ЊؑȄР,Р܄Thȉ ϠĈ ȍ|РРؔԌϠ <<̆<Ȇ<̋<ڀȊ@̅̃ȋH̯<<@ؓȄ̄ʰ<<`@<<@<@<ddHڀHtȍ<<̈ڀt؅@@ $DDLL@Ȏ̄@ȇ8̊ȇ8̢ؔ܄ ح܅   ܅t   `hHtDtt<lD؉,hlؒ`dt,ؖT,ȋ؅؊؋؊؋TX|ВĈXԃ,X|؈`؉hTXX|Ї،|̇̄||І||̆|І|̆|І||І|Ї|Ў6 |І|̋|̆|̈d|̈d|̈|܆|̆|̆|̆|̆|̆|̒6 |Г|(|Њl|̊l|̊l|̊l|̆|̆|̆|̊XXXXXXXXXD؊X؋|؉؉؉܈4|̆04,|؆܆̄||ЅD|І4܎|Ѕ|Ї||̅|܇|܇h|Ѓ؈|Ѕ6`؋T؋PШ44؆Ќ؋В؋؋ЏЎ4P؋ЇЇ4؋ЯЏlP@ppUUDkDtH؊АpІ؇І4؄Б444,دDحt t :،ؙ؈؈ІЈ4<ЇЇ<ЍАЅЇld<<Ї(<Єvtȇ̉ȇt8 ȓt̄Đ؅@Ȍ̆ Ȉ̄@tąDt :Ȋ̉ܜ@t؉؉؊؉؉㠊찃@찄؆㠊㠑؉؉㠈㠍㠉@t㠉㠑찃@@tDؖ㠇T 찑DDDDD44tH찊؊㠙DDDDDDDDD؅㠏؅㠐؅㠮찚D4DDD㠕4 44B04$lІԇD3@D @"DD @D9,   hD  3, hdh @D888p, <Ht ,ht@hpDHx(DDDLHDDH DphD$xL$8`DȆȅ(;p3(tpDDDD98| (H3(txT$DxT`TTP̆̅̅̅@D̅(3(̇ D̊P Pdtd;p̏Ȅ0$3((;p,  LHEЇĄ(((,,(PT,ԳԗԌԃT܆LTPlpxTdYTZ@n(n4ԃԃ؄LЄԘH؃ЃH̔eБH8d4,sp[,ЗDȄD,]0b^@m`_b`̌4,4[sp\,ffz`PȞ<<ІԈĉ,,,,,@DԇЇx8D؆DD̆DpВ\\\\d@\h`\hTTh(\d\ \Ď4 P0P$̹4,\ą` @hĐ`܅H`0PhȈP\\hd0ddPȇl(l0P$hTPtP0P@\004LP8`d\dT4\hd\`````hӠ((P0ptp0Tp p0h`<ӠӠӠӠӠh`<tpԇנ4H@<<@DЌЙ D<pLІԚD`<H< @HԑԗԔԕԅpЈԅ` p pӠ$Ӡ p p pd0PӠ0І p,d plӠhP\0ȉЍ plЎ 0hӠӠhPЖ\PȉȊ0P4ȉ @,0hӠdP,$044$tІ pdІ pd! ,ę! 8,8! ! ! ! ! !  !  4"$$% (Ĉ),)Tt(()T,Tttttt(),)$(6)(),)t9dTT:dTlTlttJ@J@J@tttOtttttttOЌtttttttttttttZ0Z0Z0Z0Z0TZ0% % ďȄȇȃtttt6666ttttc` \q@ <o` h@h0l@Ԉԅtt@t\@t\r:4D  upL0Dd 0dPD|dd܋P0P$t0PdPlhlhTThhTT \\\T0hTPDDDDXXXt $؟$ttX\\\T0hTPȄxDDDDtttXXh4̠h\\dP0Pp̏l̠̠\̠̠P0P$```d\̠\(X̠ `0P`̠` d`Ȋ$P\4d440P$4\4d44``Ї$Ѕ$@tD܄(t܅<tPЄг|\pPdHHHHDHDPdPdPdPdxDԆH4ḢLЌDHH؏ԅ̈@<4,(DtĊČĆȃ̅Čȉ̆؇؊ĉĆ܃ ܃,܃,܃t܇t؎̈ȇ̉ؒЈԅؘȊĈ؋؋ȋ@DȊȊ@$DȄ,0 BЍȌ؃̇tt7t@D|D@DtȾ̆tBА؅8؊̆ ȇ8̋Attt@DD@DdćăȆFLt||LtttMPTD|4HH|8||<|<ȐȌ<HH@<WPVІԈĈ @D D,lD4@ȆD ` 4@ȑTT     TT pTT `d hX  ,,  d        \ċT4444   @PD@DH4HH ܌  D,,,,`T```T`TTTTT` @DPPPP`t     ̇ @$DD@@$D  pHTTTTH`TTTT@ȆȆȆȋH@ЈLLXHD(HLP$(@@ttddpPZPD D D(D@D(PPPL04LLL04tttttttt,,,,,,44P00P0&HTT@H@TTȆȇHHHPPpH@0pHH,,,,Tȅ@H@Ј,,,,,,,,,,,,,@,,LXXTЎЊ((88DDDPD@DP8  @tTTTTPP8xdpx!P!P<xp"HTT%H&@TT&ȆȇH&LP&&&  ,0\0(T,h2p H\TT5H8TT9pȆȇH9p($Ѕ@@<XPLHԍLD(DPPHLHԕąȆȃ9pĈȃ9pTX9p9pt$$Lĉhdpt\,LPDeeee,pX\`dh|HttttHHH(h (T$0HlHltt$$pl\\PDDi,HTTlHmЈTTnȆȇHnЈH̚LPnntḨdldyЇȑԌtȇ̉ĉ@DЃȎDćԌ܊H@DDPHؔ؋`` t444 ؝ 4  d,$ T,,,TTTHHTTTT0ȆȆȆȋH0ЈЈа,,,,,,LLXD(XL(LLLЊЊЋ0$$$PPPP  Հ Հ֠֠ՀՀ֠֠00PP0P0PDDD0ttddppxdxdppxޠ4ІԈЌ@DDЉhh$``ĉ0$(ą,Ą,Ą,,444H܇,`$$hԏHԍԏ,,4ԏHԍԏ,,4@@DDD04H$D08 P"( @ЃԎЇ,,,,,@DЇhЇ@hĪ$Ȉ`44ĉ8(((ď,H܃$ȃĐ8`čDԆԒ4H̎HDH̐@<4,# vІԈ((@hh$ȉ`Ć*p8(,+@@<ԊDH܇$Ȅ+8`3NІԈĉM@Db D_0b_0_0b _0Y_0hp_0hp_0d,b_0_0_0b Mb _0Vb _0eb cPetė̅N((ThphiDԪ8ԑ,4H44,\`ȇ4ThpThphp`܊Hhpb bhpddhp`dddhpb bhp̆e@$D@$Dk>pt܆Ln|ptHuЊHTvȄHvЇ,LLTX8LT(Є88  vv<d<dpxxԇԑP$HȈHȚ@@DpDDD@dDD@@dD@d@ddPHH܇tP~ЃԎP@D܈PȆȇD܋DD܄܄܎܆H܈܃ DHاؕԌ4Hآ؆ԃĈ h888t8$,`,LT,pDx`$,,LHH,H\ۀ|ۀۀppۀpİ 0 ۀۀۀۀۀۀ@@@@@А0Є0PІԈĉ@D pD    Ј P P  p P p P   p ̌̉ h @h$`Ē ``̃4(( p, DԪPDD4HPԊPPԑԇ@<LPP,ąȆȃĆȃ p8Dț p `H `܈ p@ pDtL p p̄ĉ pL@ Ј$tD p  p$D8` ^t %` %`t %`t %` %` %`tLtP\d 0 j(((L|D(((D  7pD 4tt 4DDDȆt(((( > @ ? > Ctt  R`t Ht 7pt  @p H@t @pt @p > @tt >t ^ ` S c T S aP T aPԆ TԈ @ R` @p @lTt @tԄćĆ @tTxT 0DDDDDDDDDD DDD@ @pD    ȅ@ $D `, t `,ԄԄ`ԄԄ,DȇtD 0 0  0|4܉|4܉ c H@4܊ @Ȇ$D x4܇|̇d  0    ̅  t $|؈t $|؆ȃȇt p|؈|؈ԄȇԄt p ʀ,|84 pt 0t 0    ʀ  ʠ  xltpt а0\|DD0 @ @t  ċĄ 0 0( 0|D0|D 00|t||,8<Dt TDDDDDDDDDpPDDH (    ЉlȏTȊXȌXlD   `Xlȓ XȊ@ $D  ؈̇|||tL vD j j v j v v v v v l`(,|||t  gP v u v v gP v v u j gP v v l`<t(t<@|||t  vX` gP v u vإ̊ v u gP v v u v j v l` gP v,ܐ؇@0ܐ؆D4ܐ؇H\  v u gP l` sPd l  ut \X@xX,,@,@xX|TX ̈XXXXXXXXX j̈ j܈ j܈̆p̆pԈ܆І̆|؈@̏ ̉ j uLD jt8 V V8 V؏؎؅؈ VX V @8X V VD sPx gP gP sP l` gP wPk( wP wP wP }|t,88d<,tt4tHL|܅ԋ|܅|܅L|܅|܅|܅|܅|܅L̋܅܌L̋܍|||tԓ̊|܈|܈܅܈|܈ԗԉؔ؆؇Ԇ܄܋|||t|؈PL|؇$H|؅|؅|؃̋|||tt̋|||tt̋|||t܇ć̒|||t|؉|܉ԍ|܉Ԉt|||ttȅtt|(L,0,t$tHDHH̏̋@<<@ tt tttttttttttttttt tttttttttttttt t t t tttttttttttt$(4,0tHt  頚tttttttttttD в   @|؍ HH8tԧD؇HHH|ؑHHԄDDD  8 |؈|؃D@@DHHHHH<H4|؄|HHD@D|؉@HH<HHD4HH|؄@|ؗ@DDHH@D8H|ؖDHHDHHH HHDHHH HHDHHHH Г|؎H Љ  |إ  HD\`t|ؙ HHHHHHHHHHH Г|؎H Њ  |؊ L @D`HHH\HHHL HH Ј  |ؗ    \ H `DHHHHHH Љ  T|    L @HHH\ HH`D|؇HHHH|؅HPP Љ|ؒ XX\ Ќ|ؒ \` М TT Ќ|ؔ В|ؖ ПDt`|؅ Љ|؇HH Д|ؔ @ ОD D @H З8H؇HHHHHHԄDHHHHDHHHHHHDHH Љ  |ؓ @D @8 HH؆DHHHHԄDDHHHHHDHH  Л \ О |`D ЊHHHHH Жh L @`h|،H\LHH   @H|ؖ48ԒD|؉HHHH @tttth Йhh|؍|؍|؍|؍HHHtH ,HH4܄xXD܄xx܄xX,|L4܇܇X,X@x܄x|̈dhԃ4܄xX|܈D,ЉpԄPԄxԉD|܈|܈ԃ4܄x,\4,`ԅtX,$,|xxX,dԅtD<DDDPX,hԅt|܇t(4Tt@@Ԅ(4$$DDD pHDDD$D$Ȋ  (4,,ЍTX|܈|܈ Ϡ8((( נ  ڠ lllll(  ڠllh lll$l8lll4x DDllll4(x 0xl4l00l0l 0tt "DTppDX|؆X|̇|@|؇pXlxxẌ@lXXІ,̕؄؋XxxTX|XpXXlЃx|pЈx0XXhdЃhdЃtxtЇdІh̅xІČ, ` `ЇlЉpp؆؇ȌІ؆, І܆܈ЈІ܇hh<<<<<<<<<< <X|܋|ؓ@ttإ؉xԱXԺtАttАĒtЗЋt 6p\t88888tDDDt8ԅtDDDXĆDDȊDЅ|܋ȇDDDDD|܇xtxԆ8Ȇ88Ԇ88ԌtttttXX̅̆x̆TX|ЇXXXXXXXXXXXT̰T̆Ј܈ЄЄЈЈ̈̆pЯ̮̉܈Ѓ@lX DDp|ؐ T|܈ЇX|؇pppphȉ`|Ȅtt ~t ~ t( t(xtt t|؉ԉ|ܧ̞ 0 Аt tt(PL||t|t0,4,,D@H@@PLTLPLTL؉܍Ē ؉܍Ē ԣ؛؉܈Đ؉܈ĤDԣ؛܌ ܌ ԣ؛؉܊Č ؉܊Č ԣ؛؉܊Č ؉܊Č Ԑԧ؏؟܌ ԣؙt $0؉܊ĦԋttԚءDԮ|Ԗt|؉ 0tt ttt|܄|܃؆܋|ؓċ؆܊|؎ė؆ܜčė؆܈|ؖԛ|؉؆܋|ؓąĘ؆܉|ؗ|؇ԍĘ؆܉|دԍ|؇ ܊|܏؆ܥĈ|ءt|܆Ԉ|؉|؉|؇|؈Ԑt -|܈|Ȍ̉|܋Ȅ|܈| 9$$|8|܄ȅȉ8̌DȒ|܉̅̊|܅|܇pp|Ј|܋|܈̈p܌|܇ṫ|܅̆|܈̆|܈TX g T W Z  Z ]@ _0 a b d hЊ j  l0 mЄ PX̅px|܆X̅̅̆̅xxX|؄|؅ОЅ|܇X PXlDXxďXDX PXl|܆Xȅ|ԅ|Ԇ|܆ PX|І|܅X|؅X|؅X؆|x|ԃ 9̆ rtt$|||t {$  ~  ~ И Ў      А      P   0 0 0                0     ̙        ~          Б ll `l ` `l  Ж  ll    Ўll p( p p pPL p p p pPL   pPL   p DDD$Ԇ8tTX P    `  P     Њ   p  Њ ` Љ ƀX<̅x|܅X<|܅xX|̅̉XԅpẍDp̅Xp|̅|̃X<D|܆@|܆|̆|܆@|̃X |̅|̃X̅pxX|@ЄІX|̅|̅|܅xX$|Ѕ|ЅX<X̅px̅pX|ЃX$|ЅX̅@pxX|ЃX|ЄX$|Ѕ̉Xxp̌x̅p̅pDp̅X|܍|؏X܇x܈X|x|X|̆X܇܇|X܉ܝx|܄XTpT|̈|TܖX ް؎؎| 0 0 ` ` |Ѕ|؇|܇ `ĈD ЈĒА Њԋȅt(0ȋȒ(Ȉ؅``ܖ px 4 pȆ p p p @ D0ȌHttt pԅt pȌ pԅtD,HȖtH `pDt̏ ȄȒh(((<tDȏ(L(tt@tttt@LPt\@dX`pȆ|||t?@ȃ|||tX?@Ќ`|||tȅȅ<̈@ȊDXЌ`ȆtȐȅ|||tІ<<d(<ԇЌ|܊X~TXrPXrPXu@|؅|܈̏@|؈ԄԄu|܈@@|ԄrPs |܈Їćȃȃȃȃȃw0 Jԓ|܊X\\\XX$$$TT8((<|x؅hzt|܃|܃̊{̄xX|܉T|܅܅|܅hz|܅|܃А|܌Ȅȉ܈̄xtܜXz|܅̅xzz|܈XX|܈D@ȄxzȉXȃzl@|xDX|܇̈,(<X|܆z|܆|xX|܆z|܆|xx̅Xz|܅|܅XDz@|xD|܅Ẍ,(<X|܆z|܆xȄxzȉX|܅Xz̅x|܅Xzz,|܆|܆|x(XXzz,|܆($|܆|x|ẋxtЅȄ؆t؅t|܆|܆tz|܇ttt|܇|܆TXt` p`ІP @tX̅xXl@|xD̈,(<X|܆|xX|܆|xXx̅XȄx|܆XD@|xDtẌ,(<X|܅xT|܈tX@p@Їptԏ@̇,(<|xD̅@|xD̄ẋ,(<̄xH̄x܃܄܎܄t{tzt̕tttt|܆ ^<8d  `` 08@48,8@|ԅX|؆"ȏp8`phpp8p8`p8p8$Ȅp8p8p8ԄȄ`|||Ȇ$Ȇ$ȉ@88h@ DDȆDHHHHHHHLHHH0<`h`ẊT̆ȃT|܃|܇|܇̈|܇|܄|܃8lXԍ̑D|||ttDt tt(|ؖ|܄tt|܅H|؃<<@. Ph|ܢ܋܉|؅t|ؖܓ܇܍܈܅%p%4lȌ`@tȆt@@@@432 h@32 h@(t\44;"tt(d<=`=`M@pFNlFphlM@p,Dpp,,DDDDDhdph|pT܈T̆xxSD,,Vaaȉ 8a\\[[,ܔ DD[ aXX|܇ |܇̄ |܇\`|܇̄`|܆̇܆$( |܈  |܇܆؊(|܈|܇܆X|܅|Ѕi,pL4Ȇĉȅĉ\PDiii pt`z,̄t0t0tԈԩ0t it(tt(ttȐtt .d040`>8؎؊\<dpD<ȈȊǐl0pǐ\pt(04t ȆȈ͠^H|||t̅̆РP`t`|ܒH`\`|܍`\```HHpP`X`\pTHH\D\`tD`tHHHHP`X`\THH\D\`tD`tHHHH`H ` H@`@H`HH ` HHHH頒`頟HH ` HH`HHHP`HHHH|܇```<84tHH|؆```|܈`H|؈`|܇|؉DHHH؉D@|؇$|؈@DDD@0|TXXX܊܊XXT ؈؈ T؈T܈ p|<@܆ЃԄ 0C @ԝԉԔԟԞppDDDDDDDDDDDpԢXp  0 0,L.pHPx @  4@94444444I444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444tU44444444444444444444444 q4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444(4444444444444444444444444444444444444444444444444444444444444H444X!444444444 4444444$444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444)d4444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444)@4444444444444444))4444444444*TT444444444444444444444+d@4444444444444444,$B44444444444444444444.4444. 4.444444444444444444444444444444444444444444444444444444444444444444444444444445d44444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444444446{44444444444444444444444444444444448`44444444444444444444444449444444444444444444444444444444444444:pF444444444444444444;v4444444444444444444444444444444444d5%Tk_DefineBitmap>p?d64VTk_NameOfBitmap?p@,6lTk_SizeOfBitmap@0A6Tk_FreeBitmapAB6Tk_GetBitmapFromDataB C|6BitmapInit0CE7(error_bits(gray12_bits`gray25_bitsgray50_bitsgray75_bitshourglass_bitsinfo_bits  questhead_bits8 question_bits warning_bitsGnameTable)RidTable)_tkPredefBitmapTable*(gdataTable*`m initialized(./tkUnixSend.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixSend.cRegOpenEG7pjRegFindNameGIh7RegDeleteNameIpLH7RegAddNameLPMh8 RegClose MpNp8,=ValidateNameNpPx8TServerSecure0PP8xTk_SetAppNamePTd8lTk_SendCmdTp^L8TkGetInterpNames^Pa9HSendInitab9"SendEventProcbnl9vAppendPropCarefullynpn9AppendErrorProc0oo9DeleteProc0op:SendRestrictProcpq,:@UpdateCommWindowq0q:Td__libc_attrtkDisplayList*registry0ppendingCommands4tkSendSerial* sendDebug8$./../generic/tkAtom.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkAtom.cPTk_InternAtomqr:Tk_GetAtomNamert$:AtomInitt0uL:atomNameArrayp./../generic/tkEvent.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkEvent.c Tk_CreateEventHandlerwpx;8Tk_DeleteEventHandlerxy|;pMTk_CreateGenericHandler0yy;uTk_DeleteGenericHandlerzzd;Tk_HandleEventzp;TkEventDeadWindow<TkCurrentTime<(Tk_RestrictEvents D<<8Tk_QueueWindowEventPLlastGenericPtrDK genericHandlersActiveH[eventMasks restrictProcLrestrictArgP./../generic/tkGrab.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkGrab.cTk_GrabCmdp=,YTk_Grab\=\Tk_Ungrab`=PReleaseButtonGrab0X=~TkPointerEvent`(=]TkChangeEventWindow0> TkInOutEvents(>@<MovePointer20x>}TkGrabDeadWindow08? EatGrabEvents@?PGrabRestrictProcd?p QueueGrabWindowChange0p?4GrabWinEventProc04?[FindCommonAncestor@(?TkPositionInTree0?TkGrabState  ?tkDisplayListbuttonStates P Z./tkUnixEvent.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixEvent.cE8TkCreateXEventSource|@<SDisplayExitHandler @\lTkpOpenDisplay0l@|TkpCloseDisplay0p@DisplaySetupProc@DisplayCheckProc@DisplayFileProcA<]TkUnixDoOneXEventApTkpSyncLAtkDisplayList initializedTo ./tkUnixWm.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixWm.cLxTkWmNewWindow0PBTkWmMapWindowB0JTkWmUnmapWindow0 BoTkWmDeadWindow ,BTkWmSetClass00CLTk_WmCmdCl?Tk_SetGrid|CTk_UnsetGrid0CConfigureEventDCReparentEventPD< ComputeReparentGeometryDh WrapperEventProc|D TopLevelReqProc0D UpdateGeometryInfo E  UpdateSizeHints E fWaitForConfigureNotifyDE WaitForEventPE WaitRestrictProcE WaitForMapNotifyF ZUpdateHints F, yParseGeometryFH Tk_GetRootCoords xF aTk_CoordsToWindow  FUpdateVRootGeometry F_Tk_GetVRootGeometryG Tk_MoveToplevelWindowGTUpdateWmProtocolsGTkWmProtocolEventProcTGRTkWmRestackToplevel`G.TkWmAddToColormapWindowsH\TkWmRemoveFromColormapWindowsHTkGetPointerCoordshHGetMaxSizep HHVTkMakeMenuWindow P!$HCreateWrapper!0"I$TkWmFocusToplevel""ILTkUnixSetMenubar#%I`nMenubarDestroyProc0%&0IMenubarReqProc0&0&ITkpGetWrapperWindow&&Id__libc_attrfirstWmPtrX wmTracing\$wmMgrType h-menubarMgrType x B./../generic/tkGeometry.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkGeometry.ceTk_ManageGeometry&'|J Tk_GeometryRequest0'( JHTk_SetInternalBorder ((lJlTk_MaintainGeometry(p+XJyTk_UnmaintainGeometry+`-xJMaintainMasterProc0-.XK,MaintainSlaveProc .`.K\"MaintainCheckProc.0K|<maintainHashTable+ B initialized` ./../generic/tkGC.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkGC.cZTk_GetGC04K8Tk_FreeGC45L4fGCInit56L`'valueTable+X4idTable+: initializedd ./../generic/tkCmds.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCmds.c 3Tk_BellCmd6 7LfTk_BindCmd79LTkBindEventProc9;LTk_BindtagsCmd<?M`fTkFreeBindingTags?@\MTk_DestroyCmd@`AXMTk_LowerCmdA`BN,Tk_RaiseCmdCDN\-Tk_TkObjCmdDGNTk_TkwaitCmdGKlNWaitVariableProcKpKNWaitVisibilityProcKKNWaitWindowProcKKN0Tk_UpdateCmdKMOzTk_WinfoObjCmdMgO\ TkGetDisplayOfghOCTkDeadAppCmd0hi0OaGetTopleveli0ilOtkDisplayList p./../generic/tkGrid.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkGrid.cjTk_GridCmdipO~GridReqProc PGridLostSlaveProc0 PAdjustOffsetsPgAdjustForStickyTQdArrangeGrid`QxPResolveConstraintsQGetGridRHSetGridSize0 RtCheckSlotDataRiInitMasterData0RUnlink0RDestroyGrid0$SGridStructureProc00\SDCConfigureSlaves`S StickyToString ӀT4 "StringToStickyӀTPgridHashTable+ initializedlgridMgrType ./../generic/tkVisual.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkVisual.cZTk_GetVisualTnTk_GetColormapPTTk_FreeColormapPxUTk_PreserveColormap0(UDd__libc_attrvisualNamesO *./../generic/tkFocus.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkFocus.c"]NTk_FocusCmd0UTkFocusFilterEventUSetFocusV0[GetFocusVTkFocusKeyEvent 8VTkFocusDeadWindow@VGenerateFocusEventsTW@FocusMapProc0`W8%tclFocusDebug, ./tkUnixEmbed.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixEmbed.c'aTkpUseWindowW|TkpMakeWindow WTkpMakeContainer0W<EmbedErrorProc W[EmbeddedEventProc  hX {ContainerEventProcp0X,EmbedStructureProc0XPEmbedFocusProcXxJEmbedGeometryRequestPXyEmbedSendConfigurePXTkpGetOtherWindow  XTkpRedirectKeyEvent0lY%TkpClaimFocusp0Y0VTkpTestembedCmd0(Y\EmbedWindowDeleted 0YTkUnixContainerId ,Y1firstContainerPtrp0 ./tkUnixFocus.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixFocus.c,(TkpChangeFocus0 Z  ./../generic/tkPack.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkPack.c-Tk_PackCmd ZLPackReqProc   tZPackLostSlaveProc0  ZArrangePackingPZ>XExpansionP[t~YExpansion[GetPacker[PackAfter[Unlink0 \ DestroyPacker   \0)PackStructureProc0 #H\PConfigureSlaves#P1\gpackerHashTable,m initializedtypackerType w g./../generic/tkMenu.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkMenu.c<3;Tk_MenuCmd16]4MenuWidgetCmd6E]mTkInvokeMenuEG$]DestroyMenuInstanceG0Ix]"TkDestroyMenu0IJ^@`UnhookCascadeEntry JK0^pDestroyMenuEntryK0M^MenuWorldChangedMM^ConfigureMenuMP_ConfigureMenuEntryPU_LdConfigureMenuCloneEntriesUXH_TkGetMenuIndexXP[t_&MenuCmdDeletedProc [[`LMenuNewEntry[_`MenuAddOrInsert_d`-MenuVarProcde|a,xTkActivateMenuEntry0ef`aTTkPostCommand0f`faCloneMenufla MenuDoYPositionlla GetIndexFromCoordslnxb RecursivelyDeleteMenunoPb0 TkNewMenuNameoPqb` ^TkSetWindowMenuBarqtb DestroyMenuHashTable0ttb TkGetMenuHashTabletuc  <TkCreateMenuReferencesuv$c, hTkFindMenuReferences0v0vcL TkFreeMenuReferences0vw cp DeleteMenuCloneEntrieswxc TkMenuInitxxcd__libc_attrtkActiveUidtkDisabledUidtkNormalUidL menusInitializedxTtkMenuEntryConfigSpecs@tkMenuConfigSpecs@!menuClass5 ./../generic/tkMenuDraw.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkMenuDraw.cR.TkMenuInitializeDrawingFieldsxydLTkMenuInitializeEntryDrawingFieldsyy<d(mTkMenuFreeDrawOptions0y@zd<TkMenuEntryFreeDrawOptions0z zdTkMenuConfigureDrawOptionsz}d!TkMenuConfigureEntryDrawOptions}PdTkEventuallyRecomputeMenu PeTkRecomputeMenu0eTkEventuallyRedrawMenu0 e ComputeMenuGeometry0 e?TkMenuSelectImageProcXf dDisplayMenu`f,TkMenuEventProc0 pf TkMenuImageProcpf.TkPostTearoffMenu<fTkPostSubmenu@gAdjustMenuCoordsLgLtkActiveUidtkDisabledUidtkNormalUid[./tkUnixMenu.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixMenu.cYpTkpNewMenu PgTkpDestroyMenugTkpDestroyMenuEntrygTkpConfigureMenuEntry $gTkpMenuNewEntry08gTkpSetWindowMenuBar @hTkpSetMainMenubarh0<GetMenuIndicatorGeometryhDsGetMenuAccelGeometry<hXDrawMenuEntryBackground@Lh|DrawMenuEntryAcceleratorPh DrawMenuEntryIndicatordhgDrawMenuSeparatorphDrawMenuEntryLabeliDrawMenuUnderlinei` TkpPostMenu0i:GetMenuSeparatorGeometryiXGetTearoffEntryGeometryHi}TkpComputeMenubarGeometryPhi@DrawTearoffEntrypj8yTkpInitializeMenuBindingsjhSetHelpMenuj|TkpDrawMenuEntrytjJGetMenuLabelGeometryLkyTkpComputeStandardMenuGeometryPPk<-TkpMenuNotifyToplevelCreatePXk|HTkpMenuInit`hktkActiveUidtkDisabledUid./../generic/tkText.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkText.cdTk_TextCmdp$krTextWidgetCmd0lDestroyText äl4ConfigureTextð,l`TextWorldChanged0plTextEventProcp|l#TextCmdDeletedProc0ˀlLInsertCharsLlDeleteCharsPДm4.TextFetchSelectionРӬm`TkTextLostSelectionӰ|mTextBlinkProcԀՐmTextSearchCmdՐn TkTextGetTabs nTextDumpCmdho<bDumpLinepoxDumpSegmentod__libc_attr tkBTreeDebugtkTextCharTypetkTextToggleOnTypetkTextToggleOffType"configSpecstkTextCharUid,@tkTextDisabledUid,DtkTextNoneUid,HtkTextNormalUid,LtkTextWordUid,PtkTextDebug,TtextClassKX./../generic/tkTextDisp.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextDisp.cx(rTkTextCreateDInfop<TkTextFreeDInfo0\p`GetStyle`|pFreeStyle0 pLayoutDLinepVUpdateDisplayInfoq FreeDLinesqDisplayDLine qDisplayLineBackground Tr4DisplayText`|r kTkTextEventuallyRepick s0 TkTextRedrawRegionsP TextInvalidateRegion Ps TkTextChanged P!xs HTkTextRedrawTag!$Ds TkTextRelayoutWindow$P&t8 NTkTextSetYView&)t\ MeasureUp)+(t ETkTextSeeCmd+0.t TkTextXviewCmd.0t ScrollByLines03u yTkTextYviewCmd39uTkTextScanCmd9=uGetXView=>LvGetYView>P@tv,!FindDLine@B$v\hTkTextPixelIndexB0CvTkTextCharBboxCFv=TkTextDLineInfoFGvTkTextCharLayoutProcGJw CharDisplayProcJLw4xCharUndisplayProc MM4wCharMeasureProc0M@MwCharBboxProcMO<wAdjustForTabO@RxSizeOfTabRSxhNextTabStopST,xVMeasureCharsT0Uxd__libc_attrtkNormalUid tkTextDebugtkTextCharTypetkTextCharUidtkTextNoneUidtkTextWordUid# numRedisplays|$ linesRedrawn% numCopiesp./../generic/tkTextBTree.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextBTree.cTkBTreeCreateUVy,TkBTreeDestroy0VW yX7DestroyNode0W X0yxgDeleteSummaries0X0XxyTkBTreeInsertCharsX[ySplitSeg0[ \z4FCleanupLine\ \z`TkBTreeDeleteChars\`z4TkBTreeFindLine`a{uTkBTreeNextLineab4{@TkBTreePreviousLine0b@c{TTkBTreeLineIndexcd{,TkBTreeLinkSegment0deh{WTkBTreeUnlinkSegment0epe{TkBTreeTagei |ChangeNodeToggleCounti l|TFindTagStartl m|FindTagEndm nX|rTkBTreeStartSearchn`p4|TkBTreeStartSearchBackp@r$} >TkBTreeNextTagr0t}LTkBTreePrevTagtxL}tTkBTreeCharTaggedxPz0} !TkBTreeGetTagsz0}D} IncCount}P~} TkBTreeCheck~~ cCheckNodeConsistency~p Rebalance@~ RecomputeNodeCounts@\ |TkBTreeNumLines`pX CharSplitProcpPl CharCleanupProcP@ CharDeleteProc0@x CharCheckProc0\ ;ToggleDeleteProc` oToggleCleanupProc@, ToggleLineChangeProc0@X ToggleCheckProc| TkBTreeCharsInLinetkTextLeftMarkTypetkTextRightMarkTypeetkBTreeDebug,X tkTextCharType tkTextToggleOnType tkTextToggleOffType!=./../generic/tkTextMark.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextMark.csbTkTextMarkCmdTkTextSetMarkl@9TkTextMarkSegToIndexph_TkTextMarkNameToIndex|MarkDeleteProc (MarkCleanupProc0<MarkLayoutProc@TkTextInsertDisplayProc>InsertUndisplayProc YMarkCheckProcd MarkFindNextp PMarkFindPrev9 tkTextRightMarkType D tkTextLeftMarkType@U./tkUnixDraw.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixDraw.c:TkScrollWindowuScrollRestrictProc|./../generic/tkTextIndex.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextIndex.cS9TkTextMakeIndex\L|TkTextIndexToSeg`pTkTextSegToOffsetTkTextGetIndexTkTextPrintIndex0LTkTextIndexCmp0P@ForwBack@cTkTextIndexForwCharsTkTextIndexBackChars,,StartEnd0`d__libc_attrtkTextCharTypeW./../generic/tkTextWind.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextWind.cTkTextWindowCmd”EEmbWinConfigure ĸAlignParseProcAlignPrintProc8(EmbWinStructureProc@<8EmbWinRequestProcl\ZEmbWinLostSlaveProcpt|EmbWinDeleteProcȀTEmbWinCleanupProc`lEmbWinLayoutProcppwEmbWinCheckProc0pEmbWinDisplayProcά0EmbWinUndisplayProc ΰlEmbWinBboxProcbEmbWinDelayedUnmap |TkTextWindowIndexЀtkTextNoneUidtextGeomType`_tkTextEmbWindowTypepnalignOptionqconfigSpecsH./../generic/tkTextImage.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextImage.clTkTextImageCmd׼-EmbImageConfigurepDAlignParseProcpxtAlignPrintProcۀEmbImageDeleteProcܸ/EmbImageCleanupProcKEmbImageLayoutProcPEmbImageCheckProc0P EmbImageDisplayProcߴ4EmbImageBboxProc\FTkTextImageIndexkEmbImageProctkTextNoneUidKtkTextEmbImageTypeZalignOption]configSpecsA./../generic/tkTextTag.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTextTag.c.iTkTextTagCmd`TkTextCreateTag` IFindTag,DoTkTextFreeTag0`SortTags TagSortProc@ChangeTagPriorityTMTkTextBindProc (TkTextPickCurrent 0XtkTextCharUidtkTextNoneUidtkTextToggleOnTypetkTextWordUidtagConfigSpecsp./../generic/tkImgPPM.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkImgPPM.cYFileMatchPPM`{FileReadPPM8FileWritePPMQReadPPMFileHeader d__libc_attr4tkImgFmtPPM./tkUnixButton.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixButton.c4TkpCreateButton DNTkpDisplayButton%dTkpComputeButtonGeometry%(tkActiveUidtkDisabledUidtkNormalUidtkpButtonProcs t./../generic/tkUtil.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkUtil.c9)TkDrawInsetFocusHighlight()8kTk_DrawFocusHighlight0))XTk_GetScrollInfo*-xTkComputeAnchor-. TkFindStateString..HBTkFindStateNum.P/T./../generic/tkClipboard.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkClipboard.cv6ClipboardHandler/1H(ClipboardAppHandler1P1pClipboardWindowHandler12ClipboardLostSel22Tk_ClipboardClear2 3xGTk_ClipboardAppend35Tk_ClipboardCmd5Tk_DeleteSelHandler>?4 Tk_OwnSelection?Adl|Tk_ClearSelectionApBTk_GetSelection BEMTk_SelectionCmdEVl8TkSelDeadWindowVpWTkSelInitWY<TkSelClearSelection0YYd8SelGetProc0YZ XHandleTclCommandZ[xTkSelDefaultSelection[^LostSelection^_d3pendingPtr,\n./tkUnixSelect.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixSelect.cnTkSelGetSelection_atTkSelPropProc ae_TkSelEventProce i4SelTimeoutProc0ij4ConvertSelection"jqZSelRcvIncrProcrtSelectionSizetuhIncrTimeoutProc0upu@SelCvtToXuw`nSelCvtFromXxyd__libc_attrpendingPtr<pendingIncrsGpendingRetrievals!./../generic/tkCursor.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCursor.c eTk_GetCursory{HTk_GetCursorFromData{P~@<Tk_NameOfCursor~@FTk_FreeCursorrCursorInit\ !nameTable,`,dataTable,<idTable,B initializedG./tkUnixCursor.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixCursor.c5TkGetCursorByName`L\TkCreateCursorFromDataTkFreeCursor0`'cursorNames ./../generic/tkCanvas.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvas.cTk_CanvasCmd`CanvasWidgetCmd 0DestroyCanvas(pConfigureCanvas0>CanvasWorldChangediDisplayCanvas;CanvasEventProcƔ`CanvasCmdDeletedProc ƠTk_CanvasEventuallyRedrawTk_CreateItemType%Tk_GetItemTypes`@InitCanvas ɰmStartTagSearchɰ˘NextItemˠl 2DoItempͼ FindItemsּ lFindArea8 RelinkItemsHT CanvasBindProcP` PickCurrentItem` ACanvasFindClosest sCanvasDoEvent , CanvasBlinkProc00\ CanvasFocusProc0 %CanvasSelectTol kCanvasFetchSelection0p CanvasLostSelection0L GridAlignP PrintScrollFractionsD0CanvasUpdateScrollbarsP,TaCanvasSetOrigin0d__libc_attr0configSpecs"typeListtkArcTypetkBitmapType-tkImageType:tkLineTypetkOvalType tkPolygonTypetkRectangleType%tkTextType1tkWindowTypeallUidcurrentUid numIdSearches numSlowSearchescanvasClass&L ./../generic/tkRectOval.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkRectOval.c CreateRectOvalRectOvalCoords1ConfigureRectOvalhDeleteRectOvalpL@ComputeRectOvalBboxP|DisplayRectOvallURectToPoint0pOvalToPoint00RectToArea0D!OvalToAreaP(sScaleRectOvalDHTranslateRectOval0PhRectOvalToPostscript\+tagsOption&/configSpecs&g tkRectangleType'~ tkOvalType'/e./../generic/tkTrig.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkTrig.c'2TkLineToPoint0`TkLineToArea(&TkThickPolyLineToArea<TkPolygonToPoint LYTkPolygonToArea P (TkOvalToPoint hTkOvalToAreat{TkIncludePointTkBezierScreenPointsdTkBezierPointsp,TkMakeBezierCurve0@TkMakeBezierPostscript0TkGetMiterPoints <TkGetButtPoints "8xX./../generic/tkCanvWind.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvWind.c3CreateWinItem"@#WinItemCoords#%HConfigureWinItem%P'PrDeleteWinItem'P'<ComputeWindowBbox()x`DisplayWinItem)*tPWinItemToPoint0*+WinItemToArea+,0ScaleWinItem,0,TranslateWinItem0,-WinItemStructureProc- -@WinItemRequestProc0-@-,>WinItemLostSlaveProc0-.PL,tagsOption(00configSpecs(@h tkWindowType)canvasGeomType)P./../generic/tkCanvLine.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvLine.c8CreateLine.P1@:LineCoords1@4ConfigureLine47!DeleteLine78SComputeLineBbox8<DisplayLine<?H(LineToPoint?ELineToAreaEG\MScaleLineGITTranslateLine0I`KParseArrowShapeK LPrintArrowShapeLMP,*ConfigureArrowsMPPLLineToPostscriptPT`CArrowheadPostscriptT`Ud__libc_attrzarrowShapeOption)`|tagsOption)pconfigSpecs) tkLineType*noneUidfirstUidlastUidbothUidk./../generic/tkCanvImg.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvImg.cECreateImageUV\ImageCoordsVXConfigureImageX YL9DeleteImageYPY_ComputeImageBboxY[hDisplayImage[p\(,ImageToPoint0\0\LImageToArea\]tGScaleImage]]hTranslateImage0]^<ImageChangedProc^@_8*tagsOption+0.configSpecs+@_ tkImageType+r./../generic/tkCanvUtil.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvUtil.cI\'Tk_CanvasTkwin_@_H ETk_CanvasDrawableCoords_P`4Tk_CanvasWindowCoords` `HTk_CanvasGetCoord`ah\Tk_CanvasSetStippleOrigin apa|Tk_CanvasGetTextInfoaaTk_CanvasTagsParseProcadcTk_CanvasTagsPrintProcee|{./../generic/tkCanvText.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvText.cLCreateTextegh<TextCoordsgphdIConfigureTexthkDeleteTextklComputeTextBbox0lmPDisplayCanvTextmrTTextInsertr`t=TextDeleteCharstuTextToPoint0uvXTextToArea0v`vScaleTextwwT TranslateText0w`w@!GetTextIndexw{D`SetTextCursor{P{xGetSelText{|8TextToPostscript|@\OtagsOption,SconfigSpecs,  tkTextType-@`./../generic/tkCanvPs.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvPs.cTtTkCanvPostscriptCmd `jTk_CanvasPsColor48Tk_CanvasPsFont@XTk_CanvasPsBitmapD|Tk_CanvasPsStippleP`Tk_CanvasPsY`xTk_CanvasPsPathGetPostscriptPoints8FTkGetProloghd__libc_attrOconfigSpecs-./../generic/tkCanvBmap.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvBmap.c\ CreateBitmapPBitmapCoordsPConfigureBitmap @DeleteBitmap0lComputeBitmapBboxlpDisplayBitmappBitmapToPoint0NBitmapToArea@|ScaleBitmap@TranslateBitmap04BitmapToPostscriptT*tagsOption/.configSpecs/b tkBitmapType0`0./../generic/tkFrame.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkFrame.cahTk_FrameCmd0 XTk_ToplevelCmd0`TkCreateFrame8FrameWidgetCmdD@DestroyFrame0PcConfigureFrame8DisplayFrame$`FrameEventProc0?FrameCmdDeletedProc0\kMapFrame0` TkInstallFrameMenu X4mconfigSpecs0./../generic/tkPlace.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkPlace.cg"Tk_PlaceCmd`xYFindSlave $UnlinkSlave00FindMasterdConfigureSlavep RecomputePlacement MasterStructureProc0SlaveStructureProc0@ PlaceRequestProc @@PlaceLostSlaveProc0ۤ`k initializedlmasterTable- mslaveTable-XxplacerType3pq./../generic/tkArgv.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkArgv.coo@Tk_ParseArgv۰WPrintUsage0defaultTable3,./../generic/tkCanvArc.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvArc.csCreateArc0@ ArcCoords|^ConfigureArcDeleteArc 8ComputeArcBbox@($pDisplayArc0TArcToPointArcToArea sScaleArc  DtTranslateArc0 P ComputeArcOutline  HorizLineToArc  VertLineToArc  0AngleInRange  X4ArcToPostscript  GtagsOption3KconfigSpecs3 tkArcType5arcUidchordUidpieSliceUidA./../generic/tkScale.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkScale.cfTk_ScaleCmd  P#ScaleWidgetCmd P DestroyScale0  <ConfigureScale  <ttScaleWorldChanged @ hComputeFormat p "ComputeScaleGeometry "  $ScaleEventProc0 $ &ScaleCmdDeletedProc  & &PTkEventuallyRedrawScale0 & 'xpTkRoundToResolution0 ' (4<ScaleVarProc (@ )tkActiveUidtkDisabledUidtkNormalUidconfigSpecs5`scaleClass: ./tkUnixScale.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixScale.c%0TkpCreateScale  ) )GTkpDestroyScale  * *4bDisplayVerticalScale *@ .<DisplayVerticalValue . /4(DisplayHorizontalScale /@ 3DisplayHorizontalValue 3 4 TkpDisplayScale 4 6DjTkpScaleElement 6 9ThTkpSetScaleValue 9` :TkpPixelToValue0 : ;$TkpValueToPixel ; n./../generic/tkMessage.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkMessage.cTk_MessageCmd V0 Xh 0MessageWidgetCmd Xp [PqDestroyMessage0 [  [|ConfigureMessage [ ]xŜMessageWorldChanged ] ^.ComputeMessageGeometry ^ `DisplayMessage ` b($MessageEventProc b0 d0PMessageCmdDeletedProc  d0 dxƐ$MessageTextVarProc d f ưkconfigSpecs>messageClassA./../generic/tkListbox.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkListbox.c;WTk_ListboxCmd f hListboxWidgetCmd h ,(DestroyListbox 0 hConfigureListbox  ǠListboxWorldChanged  HǼ6DisplayListbox P ListboxComputeGeometry  X8InsertEls  ȔDeleteEls  \ ListboxEventProc ` ɀmListboxCmdDeletedProc0  8GetListboxIndex @ $ChangeListboxView  0 ChangeListboxOffset   T<AListboxScanTo ` XNearestListboxElement  ʌListboxSelect  ʠListboxFetchSelection  $IListboxLostSelection  0 fListboxRedrawRange0  4ListboxUpdateVScrollbar  PListboxUpdateHScrollbar  xconfigSpecsA=listboxClassE0./../generic/tkError.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkError.cVPTk_CreateErrorHandler  Tk_DeleteErrorHandler  ErrorProc  ,defaultHandler*a./../generic/tkCanvPoly.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkCanvPoly.cCreatePolygon  |PolygonCoords  TConfigurePolygon  HDeletePolygon  lComputePolygonBbox  ͼTkFillPolygon  dZDisplayPolygon p `TPolygonToPoint ` ΤPolygonToArea  VScalePolygon  4}TranslatePolygon0  XPolygonToPostscript  |d__libc_attr3tagsOptionE@7configSpecsEPo tkPolygonTypeFP./../generic/tkImgBmap.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkImgBmap.cImgBmapCreate  ImgBmapConfigureMaster  XOImgBmapConfigureInstance ` <TkGetBitmapData  PxNextBitmapWord P @ImgBmapCmd @ ƼImgBmapGet  @VImgBmapDisplay  <|ImgBmapFree0 @ ʈImgBmapDelete0 ʐ `ImgBmapCmdDeletedProc0 ` ˸TGetByte   xd__libc_attr_tkBitmapImageTypeFmconfigSpecsFXi./../generic/tkScrollbar.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkScrollbar.cxTk_ScrollbarCmd  PҴScrollbarWidgetCmd P \ConfigureScrollbar ` ۴BTkScrollbarEventProc0  `0ScrollbarCmdDeletedProc  ` ݨpTkScrollbarEventuallyRedraw0 ݰ 0ӐtkpScrollbarProcstkpScrollbarConfigSpecsG+./tkUnixScrlbr.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./tkUnixScrlbr.c>TkpCreateScrollbar0 0 ޠ_TkpDisplayScrollbar ޠ lTkpComputeScrollbarGeometry0 p (fTkpDestroyScrollbar0  tPTkpConfigureScrollbar  4|TkpScrollbarPosition @ Ԡ&tkpScrollbarProcs-F./../generic/tkMain.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkMain.cCWTk_Main  StdinProc  hQPrompt0 p 02interp3command-5line.x7 ttyP./../generic/tkImgGIF.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkImgGIF.cȆFileMatchGIF  pFileReadGIF   $ՐStringMatchGIF 0 StringReadGIF  ReadGIFHeader  $ReadColorMap  DDoExtension  p=GetDataBlock0  ֠RReadImage  ּLWZReadByte  HD*GetCode P (lmInit 0 <Mread @ Mgetc  <4char64 @ hFread0  |PtkImgFmtGIFJl fromData: ZeroDataBlock ./../generic/tkEntry.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I. -I./../generic -I./../bitmaps -I/usr/csbmb/src/TclTk/tcl8.0/generic -DHAVE_UNISTD_H=1 -DHAVE_LIMITS_H=1 -DSTDC_HEADERS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -n32 ./../generic/tkEntry.c@^Tk_EntryCmd  ظEntryWidgetCmd  !3DestroyEntry0 ! "iConfigureEntry " %h<EntryWorldChanged %p &dDisplayEntry & +وEntryComputeGeometry + .WInsertChars . 0\DeleteChars 0` 1@EntryValueChanged0 2 2p*EntrySetValue0 2 3ڠ\EntryEventProc0 3 5lEntryCmdDeletedProc  5p 5GetEntryIndex 5 8(*EntryScanTo  8 9\L`EntrySelectTo0 9` :HlEntryFetchSelection :P ;(۔EntryLostSelection  ;0 ;EventuallyRedraw  ; ;&EntryVisibleRange ; <]EntryUpdateScrollbar < =@EntryBlinkProc0 = >pdEntryFocusProc0 >p ?܈EntryTextVarProc ? @ܨtkDisabledUidtkNormalUidconfigSpecsJDentryClassO' ~./../generic/tclListObj.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclListObj.cQTcl_NewListObj @ BTcl_DbNewListObj0 B C,Tcl_SetListObj C  EL)Tcl_ListObjGetElements F Fx[Tcl_ListObjAppendList F GݤTcl_ListObjAppendElement G ITcl_ListObjIndex I I!Tcl_ListObjLength I JL,[Tcl_ListObjReplace JP TX FreeListInternalRep T U1DupListInternalRep U Xh4hSetListFromAny Xp `xUpdateStringOfList ` c Td__libc_attrtclFreeObjListtclEmptyStringRep! tclListTypeO <!./../generic/tclIO.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclIO.cX|SetBlockMode c  cTcl_SetStdChannel c dPTcl_GetStdChannel  dP et(3Tcl_CreateCloseHandler e eX\Tcl_DeleteCloseHandler0 e f|xCloseChannelsOnExit f gGetChannelTable0 g h1DeleteChannelTable h jtCheckForStdChannelsBeingClosed j k<Tcl_UnregisterChannel0 k  lPTcl_RegisterChannel l mhpITcl_GetChannel mp oTcl_CreateChannel o q Tcl_GetChannelMode q qTcl_GetChannelName q  q(-Tcl_GetChannelType q0 q8HTcl_GetChannelHandle q@ q(kTcl_GetChannelInstanceData q qHRecycleBuffer0 q r\DiscardOutputQueued0 r s CheckForDeadChannel  s sFlushChannel s vCloseChannel v xPtTcl_Close xP zPTcl_Write zP {LHMDoWrite {P 8Tcl_Flush0 @ d 1DiscardInputQueued p  _GetInput  , CopyAndTranslateBuffer  L ScanBufferForEOL   VScanInputForEOL  X GetEOL0 ` < Tcl_Read   ,DoRead   qTcl_Gets   Tcl_GetsObj  D Tcl_Ungets  | PTcl_Seek  @Tcl_Tell @ Tcl_Eof   Tcl_InputBlocked  DTcl_InputBuffered  @XTcl_SetChannelBufferSize @ plTcl_GetChannelBufferSize p x@Tcl_BadChannelOption  <~Tcl_GetChannelOption @ lETcl_SetChannelOption p GCleanupChannelHandlers  0}Tcl_NotifyChannel  hUpdateInterest0  xChannelTimerProc0  ,2Tcl_CreateChannelHandler 0 4Tcl_DeleteChannelHandler @ lDeleteScriptRecord0 p ,CreateScriptRecord  8XKChannelEventScriptInvoker @ Tcl_FileEventCmd  TclTestChannelCmd  Д5TclTestChannelEventCmd Р  TclCopyChannel  TFCopyData  ߤ CopyEventProc  ߰ "StopCopy   nestedHandlerPtr,firstChanPtr0 channelExitHandlerCreated4+stdinChannel8, stdinInitialized<-stdoutChannel@. stdoutInitializedD/stderrChannelH0 stderrInitializedL 3!R./../generic/tclObj.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclObj.c$~InitTypeTable  XFinalizeTypeTable  FinalizeFreeObjList  TclFinalizeCompExecEnv  dTcl_RegisterObjType0 p )Tcl_AppendAllObjTypes  <[Tcl_GetObjType0 @ ,Tcl_ConvertToType0  LTcl_NewObj  l Tcl_DbNewObj   ,TclAllocateFreeObjects   ,^TclFreeObj0 0 Tcl_DuplicateObj  Tcl_GetStringFromObj0  d<Tcl_InvalidateStringRep0 p \*Tcl_NewBooleanObj0  D|iTcl_DbNewBooleanObj0 P Tcl_SetBooleanObj  4Tcl_GetBooleanFromObj @ DupBooleanInternalRep  SetBooleanFromAny  tUpdateStringOfBoolean0  Tcl_NewDoubleObj0  Tcl_DbNewDoubleObj0  Tcl_SetDoubleObj  (Tcl_GetDoubleFromObj  <NDupDoubleInternalRep  0lkSetDoubleFromAny 0 4UpdateStringOfDouble @ Tcl_NewIntObj0  @%Tcl_SetIntObj @ STcl_GetIntFromObj  X$DupIntInternalRep ` PSetIntFromAny  d UpdateStringOfInt  4DTcl_NewLongObj0 @ Tcl_DbNewLongObj0  Tcl_SetLongObj  $Tcl_GetLongFromObj  HTcl_DbIncrRefCount  0x$Tcl_DbDecrRefCount0 0 xNTcl_DbIsShared  d__libc_attrtclByteCodeTypetclListTypetclStringType< errnotypeTable1h typeTableInitializedP  tclFreeObjList1 %tclEmptyStringRep1 O tclBooleanTypeO( W tclDoubleTypeO@ _ tclIntTypeOX\!./tclUnixChan.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./tclUnixChan.c"scfgetospeed   w cfsetospeed    cfsetispeed    tcgetattr   4 tcsetattr0  0PFileBlockModeProc0 0 l;FileInputProc  HkFileOutputProc P FileCloseProc0  FileSeekProc  FileWatchProc   h$ FileGetHandleProc p D/TtySetOptionProc  XaTtyGetOptionProc  |GTtyInit  4TtyGetAttributes @ <TtySetAttributes @ |QTtyParseMode  (Tcl_OpenFileChannel 0 Tcl_MakeFileChannel  DUTcpBlockModeProc0  HpWaitForConnect P TTcpInputProc ` , TcpOutputProc 0 8TcpCloseProc0  ThTcpGetOptionProc ` ,TcpWatchProc   | TcpGetHandleProc  'CreateSocket  @CreateSocketAddress @  Tcl_OpenTcpClient   (>Tcl_MakeTcpClientChannel 0  (hTcl_OpenTcpServer   PTcpAccept  XxTclGetDefaultStdChannel ` < ,Tcl_GetOpenFile @ !L TclUnixWaitForFile !P $< errnoUfirstFilePtrTfileChannelTypeOpttyChannelTypeOtcpChannelTypeO"r./../generic/tclIOUtil.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclIOUtil.c2R2TclGetOpenMode $ ) Tcl_EvalFile )  ,\?Tcl_GetErrno ,` ,xUTcl_SetErrno , ,pTcl_PosixError0 , -$d__libc_attr< errno"./../generic/tclTimer.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclTimer.c5InitTimer -  -hTimerExitProc  - -Tcl_CreateTimerHandler - /Tcl_DeleteTimerHandler  / 0 FTimerSetupProc0 0 0TimerCheckProc0 1 1(TimerHandlerEventProc 1 2P"Tcl_DoWhenIdle 2 3xQTcl_CancelIdleCall 3 4TclServiceIdle0 4 5Tcl_AfterObjCmd 5 =GetAfterEvent = >x,AfterProc0 > ?lHFreeAfterPtr  ?p ?x@AfterCleanupProc ? @d__libc_attr initializedX(firstTimerHandlerPtr\* lastTimerId`, timerPendingdcidleListhelastIdlePtrlg idleGenerationp#M./../generic/tclVar.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclVar.c, vTclCompileQuotes > G( yCompileBraces G0 KxH TclCompileDollarVar K X TclCompileBreakCmd X Z4 dTclCompileCatchCmd Z@ c(tTclCompileContinueCmd c e$dTclCompileExprCmd e0 nTTclCompileForCmd n` vl TclCompileForeachCmd vp | DupForeachInfo  DFreeForeachInfo P TclCompileIfCmd  XTclCompileIncrCmd  4<TclCompileSetCmd @ xTclCompileWhileCmd   CompileExprWord  CompileCmdWordInline  ,$LookupCompiledLocal 0 5AdvanceToNextWord  TaTcl_Backslash ` ĴTclObjIndexForString  ƈCTclExpandCodeArray Ɛ D0uExpandObjectArray P TEnterCmdStartData  ,tEnterCmdExtentData 0 InitArgInfo  @CollectArgInfo   άFreeArgInfo  ΰ 0CreateExceptionRange  TETclCreateAuxData  |TclInitJumpFixupArray  <TclExpandJumpFixupArray @ TclFreeJumpFixupArray   0TclEmitForwardJump 0 \:TclFixupForwardJump ` ׄ4__iobd__libc_attrtclIntTypetclFreeObjListtclEmptyStringRep tclCmdNameTypetclTraceCompile60 traceInitialized|BinstructionTableV(tclTypeTable[ tclByteCodeType]p%:./../generic/tclIOCmd.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclIOCmd.cATcl_PutsObjCmd א 4Tcl_FlushObjCmd @ Tcl_GetsObjCmd  +Tcl_ReadObjCmd  (Tcl_SeekCmd  tX'Tcl_TellCmd  `VTcl_CloseObjCmd ` pTcl_FconfigureCmd p DTcl_EofObjCmd P 8Tcl_ExecCmd @ P4Tcl_FblockedObjCmd P tTcl_OpenCmd  3TcpAcceptCallbacksDeleteProc  ]RegisterTcpServerInterpCleanup  |UnregisterTcpServerInterpCleanupProc    AcceptCallbackProc   <TcpServerCloseProc0   h$Tcl_SocketCmd   Tcl_FcopyObjCmd  !Ld__libc_attr%./../generic/tclFileName.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclFileName.cV]FileNameCleanup   !ExtractWinRoot   " Tcl_GetPathType0  ",&Tcl_SplitPath  "\SplitUnixPath  "SplitWinPath  "SplitMacPath  #,Tcl_JoinPath  `#Tcl_TranslateFileName ` ($dTclGetExtension 0 $,DoTildeSubst  $dTcl_GlobCmd  $8%SkipToChar $@ $%t5TclDoGlob $ .% initialized/winRootPatternPtr0macRootPatternPtr7tclPlatform64C&+./../generic/tclCmdAH.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclCmdAH.c3Tcl_BreakCmd0 . /(%TTcl_CaseObjCmd /0 3& Tcl_CatchObjCmd 3 5H&)Tcl_CdObjCmd 5P 6<'ZTcl_ConcatObjCmd 6@ 6'8}Tcl_ContinueCmd0 6 7'XTcl_ErrorObjCmd 7 8'|Tcl_EvalObjCmd 8 9' Tcl_ExitObjCmd 9 :';Tcl_ExprObjCmd : <(Tcl_FileObjCmd  < Nd(|StoreStatData Np R(GetTypeFromMode R  R)7Tcl_ForCmd R T)(Tcl_ForeachObjCmd T _D)LgTcl_FormatObjCmd _P ix)d__libc_attrtclPlatformtclListType&./../generic/tclCmdMZ.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclCmdMZ.c݉BTcl_PwdCmd i j8*@kTcl_RegexpCmd j@ pt*`Tcl_RegsubCmd p x*Tcl_RenameObjCmd x y+(Tcl_ReturnObjCmd y }+LrTcl_ScanCmd ~ P,$Tcl_SourceObjCmd P ,Tcl_SplitObjCmd  `,Tcl_StringObjCmd ` D-,Tcl_SubstCmd P -P Tcl_SwitchObjCmd  -Tcl_TimeObjCmd  .XTcl_TraceCmd  P.TraceVarProc P \.ATcl_WhileCmd ` /d__libc_attr'./../generic/tclExecute.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclExecute.cInitByteCodeExecution   /\TclCreateExecEnv0  `/xTclDeleteExecEnv0 ` /TclFinalizeExecEnv  / GrowEvaluationStack  P/<TclExecuteByteCode  P6/ PrintByteCodeInfo6<0 [IllegalExprOperandType<=0 CallTraceProcedure=?40 GetSrcInfoForPc?@A0 JTclGetExceptionRangeForPcABD1 ExprUnaryFuncBPD1 ExprBinaryFuncDHP1T7ExprAbsFuncHPK1ExprDoubleFuncKM`2ExprIntFuncM`P2@2ExprRandFuncPQ2ExprRoundFuncRUl2ExprSrandFuncUpW43 6ExprCallMathFuncW@[<3dTclExprFloatError[@]$3Tcl_GetCommandFromObj]0^32FreeCmdNameInternalRep0^_4$cDupCmdNameInternalRep__D4DSetCmdNameFromAny_P`4XUpdateStringOfCmdName ``4__iobd__libc_attrtclDoubleTypetclIntTypetclFreeObjListtclEmptyStringRep instructionTable< errno2 execInitialized>tclTraceExec68Gtcl_MathInProgress6<StclMatherrPtr^hZopName6@boperatorStrings^p: builtinFuncTable^a tclCmdNameTypebp'./../generic/tclNamesp.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclNamesp.c STclInitNamespaces`a(4Tcl_GetCurrentNamespacea0aP4Tcl_GetGlobalNamespaceaPaX5Tcl_PushCallFramea`b5lTcl_PopCallFramebc5PTcl_CreateNamespacecgH5bTcl_DeleteNamespacegPh5TclTeardownNamespacehl 6 iNamespaceFree llT6XTcl_Exportl`o6xTcl_AppendExportListo pT6HTcl_Importp`t6Tcl_ForgetImporttvl7@ZTclGetOriginalCommandvpv7tInvokeImportedCmd0vv7DeleteImportedCmd0ww7TclGetNamespaceForQualNamew~ 7Tcl_FindNamespace~~8^Tcl_FindCommand~(8Tcl_FindNamespaceVar0x8TclResetShadowedCmdRefs9GetNamespaceFromObj9 Tcl_NamespaceObjCmd9 pNamespaceChildrenCmd9 NamespaceCodeCmd(9 0NamespaceCurrentCmd0:  pNamespaceDeleteCmdD:, NamespaceEvalCmdP@: -NamespaceExportCmd@: NamespaceForgetCmd: NamespaceImportCmd;, NamespaceInscopeCmd;| NamespaceOriginCmd; NamespaceParentCmd,; NamespaceQualifiersCmd0<; UNamespaceTailCmd@< NamespaceWhichCmd<0 FreeNsNameInternalRep0D Greg>@regbranch\>regpiece`,>regatom0>hregnode?regc@?reginsert@ ?regtail0 ¬?regoptail °@TclRegExecl@=regtrypƔ@tcregmatchƠ@,regrepeatA[regnext<Ad+TclRegError@TAx2TclGetRegError`tA<errMsg regdummy(./../generic/tclNotify.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclNotify.c,]InitNotifier΀AvNotifierExitHandlerATcl_CreateEventSourceϐATcl_DeleteEventSource0ϐDB$Tcl_QueueEvent0P`BLHTcl_DeleteEvents`xBt}Tcl_ServiceEventҀ0BTcl_GetServiceMode0|BTcl_SetServiceMode0ԀC 1Tcl_SetMaxBlockTime0մC,gTcl_DoOneEventC\Tcl_ServiceAll0 C initializedBnotifier:@5)6./../generic/tclCmdIL.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclCmdIL.c1Tcl_IfCmdܰDTcl_IncrCmdܰެD0WTcl_InfoObjCmdްD`InfoArgsCmdD InfoBodyCmdD<InfoCmdCountCmd0hDfInfoCommandsCmdpDInfoCompleteCmd0\EInfoDefaultCmd`E<fInfoExistsCmdEhInfoGlobalsCmdEInfoHostnameCmd0EInfoLevelCmdEFInfoLibraryCmdEsInfoLoadedCmd0XF InfoLocalsCmd`F<InfoNameOfExecutableCmd0tF#InfoPatchLevelCmd0FOInfoProcsCmd0GInfoScriptCmd0lGPInfoSharedlibCmd0pGxInfoTclVersionCmdGInfoVarsCmdGTcl_JoinObjCmd\GTcl_LindexObjCmd`HLcTcl_LinsertObjCmdHpTcl_ListObjCmdHTcl_LlengthObjCmdHTcl_LrangeObjCmdHpTcl_LreplaceObjCmd DHTcl_LsearchObjCmd P I4 8Tcl_LsortObjCmd Ih MergeSort8I MergeLists@hJ GSortComparephJH DictionaryComparep(Jd__libc_attrtclListTypetclEmptyStringReptclExecutableName:h;)./tclUnixFile.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./tclUnixFile.cC>FreeCurrentDir 0tJ\FreeExecutableName KyTclChdir0K(TclGetCwdKLTcl_FindExecutable#|KteTclGetUserHome0#$L(TclMatchFiles$ 'LHd__libc_attrtclExecutableName< errnocurrentDir currentDirExitHandlerSet executableNameExitHandlerSet*D./../generic/tclPkg.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclPkg.cGGSTcl_PkgProvide' ( LTcl_PkgRequire( ,L$Tcl_PackageCmd,9LFindPackage0::\M@TclFreePackageInfo:`;MqCheckVersion ;4TclFileRenameCmd0op(s<PTclFileCopyCmd0p0phs\jFileCopyRenameppss|TclFileMakeDirsCmdsvs7TclFileDeleteCmdvytCopyRenameOneFile yLt|jFileForceOptionPtFileBasenametTclFileAttrsCmdutclpFileAttrStrings!tclpFileAttrProcs< errno0./tclUnixFCmd.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./tclUnixFCmd.c^TclpRenameFile0uTclpCopyFile uYCopyFilevTclpDeleteFile 0v8TclpCreateDirectory00vXTclpCopyDirectoryxvx(TclpRemoveDirectoryvcTraverseUnixTreevTraversalCopy v0TraversalDelete w,dCopyFileAttsw\GetGroupAttributew|GetOwnerAttribute |wGetPermissionsAttribute`w$SetGroupAttribute`x\SetOwnerAttribute|x4SetPermissionsAttributeDxhTclpListVolumes Px< errnohtclpFileAttrStringsdhjtclpFileAttrProcsdx1./../generic/tclPipe.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclPipe.cBFileForRedirectxTcl_DetachPidsyTcl_ReapDetachedProcsy0TclCleanupChildren yhTclCreatePipelinePyTcl_OpenCommandChannelPhz4< errno"detListZ1z./../generic/tclPosixStr.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclPosixStr.c'Tcl_ErrnoIdpzxTcl_ErrnoMsg ¤zTcl_SignalId°P'Tcl_SignalMsgŔd< errno1./../generic/tclStringObj.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclStringObj.c0ZTcl_NewStringObjŠưTcl_DbNewStringObj0ưTcl_SetStringObj Tcl_SetObjLengthATcl_AppendToObj `H~Tcl_AppendStringsToObj`<ConvertToStringType @ DupStringInternalRep.SetStringFromAnyGUpdateStringOfString,0tclFreeObjListtclEmptyStringRep& tclStringTyped2A./../generic/tclCkalloc.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclCkalloc.cTcl_Alloc00͌dTcl_DbCkalloc͐Tcl_Realloc0 |Tcl_DbCkrealloc΀Tcl_Free DTcl_DbCkfree0PψTcl_InitMemoryϐϘ$"Tcl_DumpActiveMemoryϠϨ8)Tcl_ValidateAllMemoryϰϸL__iob2y./../generic/tclHash.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclHash.cOTcl_InitHashTablepTcl_DeleteHashEntry0p(Tcl_DeleteHashTable0(Tcl_FirstHashEntry 0tTcl_NextHashEntryҀ *Tcl_HashStats4qHashString8tStringFind0@StringCreate|#OneWordFind׀OOneWordCreateArrayFind ArrayCreate(X BogusFind 0l<BogusCreate0p\RebuildTable$2./tclUnixEvent.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./tclUnixEvent.c"Tcl_SleepJ2./tclUnixTime.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./tclUnixTime.c$TclpGetSeconds=TclpGetClicks 4eTclpGetTimeZone @@TclpGetTime`timezone3-./../generic/tclIOSock.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclIOSock.cң&TclSockGetPortpRTclSockMinimumBuffers0[3T./../generic/tclEnv.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclEnv.cӦ[TclSetupEnv0TclSetEnv0|<1Tcl_PutEnv|tfTclUnsetEnv|TclGetEnv00EnvTraceProc03ReplaceString|8~FindVariableTclFinalizeEnvironment_environ#firstInterpPtr' cacheSize(environCache- environSize3./tclUnixSock.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./tclUnixSock.c?Tcl_GetHostName* hostname:x+ hostnameInitedE3./../generic/tclHistory.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclHistory.cط*Tcl_RecordAndEvald4pTcl_RecordAndEvalObjphtclFreeObjListtclEmptyStringRep47./../generic/tclCompExpr.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclCompExpr.cTclCompileExprhCompileCondExprp %CompileLorExpr xCompileLandExpr8tCompileBitOrExpr `CompileBitXorExpr,CompileBitAndExpr0LFCompileEqualityExprPCompileRelationalExpr,CompileShiftExpr06CompileAddExpr(8CompileMultiplyExpr0 \CompileUnaryExpr "\'CompilePrimaryExpr"`&CompileMathFuncCall&+dGetToken+p6@ Tcl_CreateMathFunc68<d__libc_attrtclTypeTabletclDoubleTypetclIntTypeFbuiltinFuncTable< errno4./../generic/tclClock.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclClock.cn/Tcl_ClockObjCmd8@>,FormatClock>@@T4./../generic/tclDate.ccc -DEFAULT:abi=n32:isa=mips4:proc=r10k -c -O3 -I./../generic -I. -DHAVE_GETCWD=1 -DHAVE_UNISTD_H=1 -DUSE_TERMIOS=1 -DHAVE_SYS_TIME_H=1 -DTIME_WITH_SYS_TIME=1 -DHAVE_TZNAME=1 -DHAVE_TIMEZONE_VAR=1 -DSTDC_HEADERS=1 -DNEED_MATHERR=1 -Dvfork=fork -DHAVE_BSDGETTIMEOFDAY=1 -D__CHAR_UNSIGNED__=1 -DHAVE_SIGNED_CHAR=1 -DHAVE_SYS_IOCTL_H=1 -DHAVE_SYS_FILIO_H=1 "-DTCL_SHLIB_EXT=\".so\"" -n32 ./../generic/tclDate.chrTclDateerror@@@HyToSeconds@PAtConvertAEDSTcorrect EF$ RelativeDateF0F4RelativeMonthFHtTLookupWordHN TclDatelex0N Q TclGetDateQSH#TclDateparseS_d__libc_attrITclDateInputJTclDateDSTmode KTclDateDayOrdinalLTclDateDayNumberMTclDateHaveDateNTclDateHaveDayOTclDateHaveRel PTclDateHaveTime$QTclDateHaveZone(RTclDateTimezone,STclDateDay0TTclDateHour4UTclDateMinutes8VTclDateMonth<WTclDateSeconds@XTclDateYearDYTclDateMeridianHZTclDateRelMonthL[TclDateRelSecondsP TclDatelval; TclDateval;TclDate_TclDates;$TclDatesj TclDate_TclDatev=(TclDatevj TclDatemaxdepth\MonthDayTablejUnitsTablel(OtherTablelTimezoneTablem(PMilitaryTableo$TclDateexcaq(+TclDateactq@DTclDatepacttKTclDatepgouOTclDater1uVTclDater2vp]TclDatechkwdTclDatedefwTclDatedebug@@ TclDatepv@DTclDateps@HTclDatestate@LTclDatetmp@PTclDatenerrs@TTclDateerrflag@XTclDatechar@\5a../../gcc-2.95.2/gcc/frame.c/usr/csbmb/src/gcc_obj/gccGNU C 2.95.2 19991024 (release)__gthread_active_p(__gthread_mutex_lock.__gthread_mutex_trylock4__gthread_mutex_unlock:decode_uleb128`mdecode_sleb128,$mread_pointerread_1byteread_2byteread_4byteread_8bytefde_comparenext_fdestart_fde_sortfde_insert fde_split)frame_heapsortGfde_merge,DmYoend_fde_sortdmn@YYY  YYYcount_fdesmiadd_fdesm  i``frame_initmvAfind_fde$m|get_cie'extract_cie_info0pXmA execute_cfa_insn]pm 00DD,TT;||4__register_frame_infom| __register_frameTm__register_frame_info_tableT m|TT __register_frame_table@m'__deregister_frame_infopm|\\ll __deregister_frame-m__frame_state_for7 dmA T Ti T Ti    d (nY  6 ../../gcc-2.95.2/gcc/libgcc2.c/usr/csbmb/src/gcc_obj/gccGNU C 2.95.2 19991024 (release)__eprintf  Hpm6/../../gcc-2.95.2/gcc/crtstuff.c/usr/csbmb/src/gcc_obj/gccGNU C 2.95.2 19991024 (release)__do_global_ctors P m6S/xlv55/kudzu-apr12/work/irix/lib/libc/libc_n32_M3/csu/crtninit.s/xlv55/kudzu-apr12/work/irix/lib/libc/libc_n32_M3/csuO __start_mcount__rld_obj_head__Argv__Argc __istart6h__do_global_dtors__frame_dummy^j TfTkGetDisplayTkAllocWindowTkCreateMainWindowTk_CreateWindowTk_CreateWindowFromPathITk_DestroyWindowpTk_MapWindowTk_MakeWindowExistTk_UnmapWindowTk_ConfigureWindow Tk_MoveWindow.Tk_ResizeWindowTTk_MoveResizeWindow~Tk_SetWindowBorderWidthTk_ChangeWindowAttributesTk_SetWindowBackgroundTk_SetWindowBackgroundPixmap8Tk_SetWindowBorder`Tk_SetWindowBorderPixmapTk_DefineCursorTk_UndefineCursorTk_SetWindowColormapTk_SetWindowVisual,TkDoConfigureNotifyVTk_SetClasswTkSetClassProcsTk_NameToWindowTk_IdToWindowTk_DisplayName*Tk_RestackWindowQTk_MainWindowtTk_StrictMotifTk_GetNumMainWindowsTk_Init%Tk_SafeInittkMainWindowListtkDisplayList3tkDisabledUidLtkActiveUidctkNormalUide -Tk_ChooseColorCmdSTk_GetOpenFileCmdzTk_GetSaveFileCmdTk_MessageBoxCmdq Tk_AddOption@Tk_GetOptioncTk_OptionCmdTkOptionDeadWindowTkOptionClassChangedPTkFontPkgInitTkpFreeColor0TkpGetColorQTkpGetColorByValueTkpCmapStressed@usTk_GetBitmap@Tk_DefineBitmapfTk_NameOfBitmapTk_SizeOfBitmapTk_FreeBitmapTk_GetBitmapFromData(tkPredefBitmapTableUCTk_SetAppNameTk_SendCmd2TkGetInterpNamestkSendSerial3GTk_InternAtom=Tk_GetAtomNameISTk_CreateEventHandlerGTk_DeleteEventHandlersTk_CreateGenericHandlerTk_DeleteGenericHandlerTk_HandleEventTkEventDeadWindowTkCurrentTime>Tk_RestrictEventseTk_QueueWindowEventTkQueueEventForAllChildren Tk_MainLoopM;Tk_GrabCmd:Tk_GrabXTk_UngrabTkPointerEventTkChangeEventWindowTkInOutEvents3TkGrabDeadWindowTkPositionInTree=TkGrabStatepPTkCreateXEventSource]TkpOpenDisplayTkpCloseDisplayTkUnixDoOneXEvent;TkpSyncSMsTkWmNewWindow+TkWmMapWindowOTkWmUnmapWindowtTkWmDeadWindowTkWmSetClassTk_WmCmdTk_SetGridTk_UnsetGridTk_GetRootCoords+Tk_CoordsToWindow|Tk_GetVRootGeometryTk_MoveToplevelWindowTkWmProtocolEventProc%TkWmRestackToplevelOTkWmAddToColormapWindows~TkWmRemoveFromColormapWindowsTkGetPointerCoordsTkMakeMenuWindowDTkWmFocusToplevelkTkUnixSetMenubarTkpGetWrapperWindowZ"Tk_ManageGeometryITk_GeometryRequestpTk_SetInternalBorderTk_MaintainGeometryTk_UnmaintainGeometry)]VTk_GetGC4Tk_FreeGC_Tk_BellCmd:Tk_BindCmdZTkBindEventProcTk_BindtagsCmdTkFreeBindingTagsTk_DestroyCmdTk_LowerCmdTk_RaiseCmd4Tk_TkObjCmdVTk_TkwaitCmdTk_UpdateCmd Tk_WinfoObjCmd0TkGetDisplayOfUTkDeadAppCmdbTk_GridCmd^fYTk_GetVisual@Tk_GetColormapeTk_FreeColormapTk_PreserveColormapqh7STk_FocusCmd=TkFocusFilterEventTkFocusKeyEventTkFocusDeadWindow8tclFocusDebugjTkpUseWindow0TkpMakeWindowSTkpMakeContainerTkpGetOtherWindowTkpRedirectKeyEventTkpClaimFocusTkpTestembedCmdITkUnixContainerId!n4TkpChangeFocusoLTk_PackCmdJr;{Tk_MenuCmd^TkInvokeMenuTkDestroyMenuTkGetMenuIndexnTkActivateMenuEntryTkPostCommandQTkNewMenuNameuTkSetWindowMenuBarTkGetMenuHashTableTkCreateMenuReferencesTkFindMenuReferencesGTkFreeMenuReferencesTkMenuInit%tkMenuEntryConfigSpecsGtkMenuConfigSpecsx9"TkMenuInitializeDrawingFieldsTTkMenuInitializeEntryDrawingFieldsTkMenuFreeDrawOptionsTkMenuEntryFreeDrawOptionsTkMenuConfigureDrawOptionsTkMenuConfigureEntryDrawOptionsJTkEventuallyRecomputeMenuyTkRecomputeMenuTkEventuallyRedrawMenuTkMenuSelectImageProc?TkMenuEventProcdTkMenuImageProcTkPostTearoffMenuTkPostSubmenuX| TkpNewMenu+TkpDestroyMenuNTkpDestroyMenuEntryvTkpConfigureMenuEntryTkpMenuNewEntryTkpSetWindowMenuBarTkpSetMainMenubarhTkpPostMenuTkpComputeMenubarGeometry9TkpInitializeMenuBindingsTkpDrawMenuEntryTkpComputeStandardMenuGeometryTkpMenuNotifyToplevelCreate@TkpMenuInitzTk_TextCmd{TkTextLostSelectionTkTextGetTabstkTextCharUidtkTextDisabledUid,tkTextNoneUidEtkTextNormalUid`tkTextWordUidytkTextDebugZ O"TkTextCreateDInfoJTkTextFreeDInfoTkTextEventuallyRepickTkTextRedrawRegionTkTextChanged$TkTextRedrawTagJTkTextRelayoutWindowuTkTextSetYViewTkTextSeeCmdTkTextXviewCmd$TkTextYviewCmdITkTextScanCmdTkTextPixelIndexTkTextCharBboxTkTextDLineInfo:TkTextCharLayoutProcot$TkBTreeCreateGTkBTreeDestroyTkBTreeInsertCharsTkBTreeDeleteChars?TkBTreeFindLineeTkBTreeNextLineTkBTreePreviousLineTkBTreeLineIndexTkBTreeLinkSegmentTkBTreeUnlinkSegment,TkBTreeTagTkBTreeStartSearchTkBTreeStartSearchBackTkBTreeNextTag4TkBTreePrevTagYTkBTreeCharTaggedTkBTreeGetTagsTkBTreeCheckYTkBTreeNumLinesTkBTreeCharsInLinetkBTreeDebugtkTextCharType5tkTextToggleOnTypeStkTextToggleOffType%"TkTextMarkCmdETkTextSetMarkhTkTextMarkSegToIndexTkTextMarkNameToIndex)TkTextInsertDisplayProctkTextRightMarkTypetkTextLeftMarkType!Y TkScrollWindowa$TkTextMakeIndexITkTextIndexToSegnTkTextSegToOffsetTkTextGetIndexTkTextPrintIndexTkTextIndexCmp TkTextIndexForwCharsKTkTextIndexBackChars8"TkTextWindowCmd\TkTextWindowIndex6L$TkTextImageCmdTkTextImageIndexng TkTextTagCmdBTkTextCreateTagTkTextFreeTagTkTextBindProc3TkTextPickCurrent6tkImgFmtPPMgTkpCreateButton4TkpDisplayButtonZTkpComputeButtonGeometrytkpButtonProcs TkDrawInsetFocusHighlightITk_DrawFocusHighlightsTk_GetScrollInfoTkComputeAnchorTkFindStateStringTkFindStateNum^XTk_ClipboardClearTk_ClipboardAppendTk_ClipboardCmd5TkClipInitK%Tk_CreateSelHandlerGTk_DeleteSelHandlerpTk_OwnSelectionTk_ClearSelectionTk_GetSelectionTk_SelectionCmd TkSelDeadWindow0TkSelInitPTkSelClearSelectionTkSelDefaultSelection pendingPtrIpTkSelGetSelection7TkSelPropProcZTkSelEventProc^;%Tk_GetCursor@Tk_GetCursorFromDatajTk_NameOfCursorTk_FreeCursorP`TkGetCursorByName7TkCreateCursorFromDatadTkFreeCursorgTk_CanvasCmdFTk_CanvasEventuallyRedrawvTk_CreateItemTypeTk_GetItemTypes1PtkRectangleType8tkOvalType0$3TkLineToPointTcl_NamespaceObjCmdltclNsNameTypeQzgTcl_GetIntTclGetLongTcl_GetDouble"Tcl_GetBooleanO|TclRegCompTclRegExecuTclRegErrorTclGetRegError Tcl_CreateEventSource7Tcl_DeleteEventSourceaTcl_QueueEventTcl_DeleteEventsTcl_ServiceEventTcl_GetServiceModeTcl_SetServiceMode"Tcl_SetMaxBlockTimeKTcl_DoOneEventpTcl_ServiceAll9Tcl_IfCmdTcl_IncrCmdTcl_InfoObjCmdTcl_JoinObjCmdTcl_LindexObjCmdBTcl_LinsertObjCmdjTcl_ListObjCmdTcl_LlengthObjCmdTcl_LrangeObjCmdTcl_LreplaceObjCmdTcl_LsearchObjCmd/Tcl_LsortObjCmdtclExecutableNamee?TclChdirTclGetCwd7Tcl_FindExecutable_TclGetUserHomeTclMatchFiles^ Tcl_PkgProvideTcl_PkgRequireTcl_PackageCmdLTclFreePackageInfoMTcl_LoadCmdTcl_StaticPackage TclGetLoadedPackagesFTcl_PreserveTcl_Release.Tcl_EventuallyFreecTclFindElementTclCopyAndCollapseTcl_SplitList2Tcl_ScanElementWTcl_ScanCountedElementTcl_ConvertElementTcl_ConvertCountedElementTcl_MergeTcl_ConcatTcl_ConcatObjATcl_StringMatchfTcl_SetResultTcl_GetStringResultTcl_SetObjResultTcl_GetObjResultTcl_AppendResult'Tcl_AppendElementvTcl_FreeResultTcl_ResetResultTcl_SetErrorCodeTcl_SetObjErrorCodeTcl_RegExpCompile8Tcl_RegExpExec]Tcl_RegExpRangeTcl_RegExpMatchTcl_DStringInitTcl_DStringAppendTcl_DStringAppendElement$Tcl_DStringSetLengthOTcl_DStringFreetTcl_DStringResultTcl_DStringGetResultTcl_DStringStartSublistTcl_DStringEndSublistTcl_PrintDoubleETclPrecTraceProclTclNeedSpaceTclFormatIntTclLooksLikeIntTclGetIntForIndex#bTcl_BinaryObjCmd  TclPreventAliasLoopTcl_MakeSafeTcl_GetInterpPathTcl_InterpObjCmdPTclInterpInitsTcl_IsSafeTcl_CreateSlaveTcl_GetSlaveTcl_GetMasterTcl_CreateAlias %Tcl_CreateAliasObj NTcl_GetAlias qTcl_GetAliasObjpTclpMakeFileTclpOpenFileTclpCreateTempFileTclpCreatePipeATclpCloseFiledTclpCreateProcessTclpCreateCommandChannelTclGetAndDetachPidsTcl_WaitPid$Tcl_PidObjCmdHrTcl_LinkVarTcl_UnlinkVarTcl_UpdateLinkedVarTcl_BackgroundError6Tcl_CreateExitHandleraTcl_DeleteExitHandlerTcl_ExitTcl_FinalizeTclInExitTcl_VwaitCmd/Tcl_UpdateCmdjtclMemDumpFileName)Tcl_ProcObjCmdTclGetFrameTcl_UplevelObjCmd/TclFindProcPTclIsProcTclObjInterpProcTclUpdateReturnInfooTcl_AsyncCreateTcl_AsyncMark Tcl_AsyncInvoke-Tcl_AsyncDeleteQTcl_AsyncReadyLTcl_GetIndexFromObjcTcl_WrongNumArgstclIndexTypeNmatherr@xTclParseQuotesTclParseNestedCmdTclParseBraces2TclExpandParseValue\TclWordEndTcl_ParseVarTcl_CommandComplete%TclObjCommandComplete;ĸ Tcl_SetPanicProcpanic panicProcvQTclFileRenameCmdTclFileCopyCmd,TclFileMakeDirsCmdTTclFileDeleteCmdTclFileAttrsCmd)TclpRenameFileTclpCopyFileTclpDeleteFile;TclpCreateDirectorydTclpCopyDirectoryTclpRemoveDirectoryTcl_SetObjLengtheTcl_AppendToObjTcl_AppendStringsToObjtclStringTypeץTcl_AllocTcl_DbCkalloc Tcl_Realloc+Tcl_DbCkreallocQTcl_FreeoTcl_DbCkfreeTcl_InitMemoryTcl_DumpActiveMemoryTcl_ValidateAllMemoryڽTcl_InitHashTableTcl_DeleteHashEntryTcl_DeleteHashTable8Tcl_FirstHashEntry_Tcl_NextHashEntryTcl_HashStatsެTcl_SleepWNTclpGetSecondsTclpGetClicksTclpGetTimeZoneTclpGetTime;TclSockGetPortTclSockMinimumBufferst_TclSetupEnvTclSetEnvTcl_PutEnv TclUnsetEnvBTclGetEnvTclFinalizeEnvironment"DTcl_GetHostName=JITcl_RecordAndEvalTcl_RecordAndEvalObj8TclCompileExpr,Tcl_CreateMathFunc"[ Tcl_ClockObjCmdeTclGetDateTclDateparseTclDatelvalTclDatevalTclDate_TclDates:TclDatesNTclDate_TclDatevjTclDatev TclDateexca$TclDateact;TclDatepactSTclDatepgojTclDater1TclDater2TclDatechkTclDatedefTclDatedebugTclDatepvTclDateps TclDatestate"TclDatetmp9TclDatenerrsRTclDateerrflagmTclDatechar__register_frame_info4__register_frameX__register_frame_info_table__register_frame_table__deregister_frame_info'__deregister_frameM__frame_state_forg__eprintf$5h__do_global_ctorsG /xlv55/kudzu-apr12/root/usr/include/xlv55/kudzu-apr12/root/usr/include/sys/xlv55/kudzu-apr12/root/usr/include/xlv55/kudzu-apr12/root/usr/include/sys/xlv55/kudzu-apr12/root/usr/include/xlv55/kudzu-apr12/root/usr/include/syscrt1text.sregdef.hregdef.hsgidefs.hfpregdef.hasm.hasm.h3 wvz}}!}}~~^H /xlv55/kudzu-apr12/root/usr/include/xlv55/kudzu-apr12/root/usr/include/sys/xlv55/kudzu-apr12/root/usr/include/xlv55/kudzu-apr12/root/usr/include/sys/xlv55/kudzu-apr12/root/usr/include/xlv55/kudzu-apr12/root/usr/include/syscrt1tinit.sregdef.hregdef.hsgidefs.hfpregdef.hasm.hasm.h  { /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkWindow.cӧlocale_attr.h춲tkInt.hǟ= !||}5xvxx  ,`_z !~~~~}1  x 3%M~~y|{zpn|{z {|,yA|1 !}}}x  nzh , %d-~~u~~~~u y,qqq  %5x~wt{1 (jj} }|z zzzzHs 0R%~~ | t!   }/p{!~  - or- vv }!~~! c}I1~~~  u u  - t ~~|) +~#tU   !~  & ~k /  {!~}2C" %sI| w~~   %- ||| $ ||| %{|zz -}} ! |}x})} w}}x})} w}zz ) }} ~|!~} ~zs sz}}$~!}y|- %|-! ~!l2 rr r}~-( u~w      x x"~)~  y z} y! -; -  r$    &~}]%\#$ & *sd 1 t{|~ |     &~ %-% h y%  $, q4QN $$$  G /usr/csbmb/src/TclTk/tk8.0/unixtkUnixDialog.cጒ,l +j ~}~} k) 1!$}A}A$ j /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkOption.cǕlocale_attr.h춲o0  $j    ~y ~.  yF (-||)~ t     k ~  " # |  {   ~  }}} } }} }}} } } }} }}} } }} }}} } } }}} }}} } }} }}} }}}}}}} } }} }}} } } }}1X7 }  }  }  }$ n $  111{ ,1   -   1rf1| -!)0 F % p( sxm=Z2}}{yk  *{}   z p y  s|u1 $- $-5z !   ~u!4-!  ~s!}) +)  ]( v  1~ , $ _A= t= *}~0s(%# w ~ >*mz}po   |~z|~|}u|2#-~%E$p 4~{L | | 9 ~}~ {{}}~ } k9~~} ,| | ' } u 1]j})$h /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkFont.clocale_attr.h춲,}{{!91!(rqq~~~{( ~ j !$~ (~~A  1( 1) )  {$~ )=#s$,s s~))=())xx ~(~)~ ~~1~*((4(DP  ~~$%3 zz  x}p~  (6  ~z~-~~~ }}~i4|||~$z   w ~  ~~~z~}|(Xn~ A,e+   T !t!k " &qpv 9~~/   q ) R A ~}+>N % J= ~ 7!  p  W$ $    y w8 {  (},zzz )5msm~~p ~q o  r  < ~ zq)~}z J) moA }|| w  wy s  }Sj$ "~~~  ~A =- }}n  F~~(|||}} n~o| a {{ ~~)j~xx epv ok ||K N4   }  x{ys s s{ [ "^$ } wEc |~s|0 n y  t t A\ ~~~uzzn!x+xx   k }n}  u  9ks5 u t  s q u u u  Y})~Kz'(9 u~~ ']($  P        $zz 6  T|~ R%o% X_Ag   $  H04(-w,~ S,-@(9T1(--  yy{{ Y~ )zzz ~    8%z  1)  )  $MH5}"yy!|~}~~~s }Sl /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkImgPhoto.c̭šlocale_attr.h춲 D$~! yy&~}~z  t &#  - |1  f p }~}}   } -  1 . ~   &~&~!   | | U-}) ||} m }$-     -1~-  ~9   ~ 9}e$%. a$  ( !w!!q! ~    ||~~|  !|~~yy{j  x ~  }  9  -~v-h~  s   y y y -.w ~~ x|d~g* ||n  llx xx  }~V 9 }~tZ $I $A SA x v} - D- - - <rr$zA~~~  !%  %1~Mt  Y - }) ) 5U$   g|)n-~ xzz  {"}}~= |< (X (X (d    ~~}|y8}8$,= }y1u(!8 S t )   (- $( || } ||{!!, }}9 t w~|!  %&l  1~~-~~|| M) Yk;~( w w  %   k   s u~|~~~~|}X  m w wo wo t U$||",uf ~!. v {}   |=%$G$6}(5~  <-zzz  no"  wn( x=E(}~~~~~ ~~k-~~ $ ~ ~) ~|P<X4 4<x5 ~ ~~F  ~u !%{!  t  s s s s s ~  ~m Z?  ~$  $  v   v  -  }| y ~ h9  v   v  - t u|z  -     %}! || }s s}~ 9 Vfk{"    |    |}pnn }  }  , }}} 9 EjI4 + xX ~, -&#]#]pwP,p }r xx%(}~~~~~~~~~ w M~  ) Z&Z&Z&Y'Y9~ B0m~/ RH{)"cmx{wyY)W'X ~1n$~~Mv{zz yy    ~ 9z* !zz11|%}{i /usr/csbmb/src/TclTk/tk8.0/unix/usr/includetkUnixFont.clocale_attr.h춲Bp% ) pp u w  x  ~#$,p~|~|  ~ }  z"($ ~!!#~~~x~| y% w w&.$e""%9  }~{{xx0mv z =}p; c c~ z z~ tsw  y {  w <|A <p#@}  $   ~~$ |(#w}P~}X~|s }~Qs ~~|- s~~|- s~~zs yyy%-{< c oycy) '|z{ ~G /usr/csbmb/src/TclTk/tk8.0/generictkConfig.cጒY$w t u5 \1} qii!.  5 % z    c!   ` q  7 y%x  ) yW!1  c) y ~ ~! ~$  ) ~$ $ ~   $ !B        ) )    ~5! ! ! ! 0*% .% ~ " nnn |n  | ,(% a})-6z~%~zk}{{)%  )% ' v v v != l| pC /usr/csbmb/src/TclTk/tk8.0/generictk3d.cؖq w v ~~~~ |,} w   jXqm~!~1=II   ~!s!$|||g)   {$  { }~|1o(  5 ~   ,    z ~& } ~| { }~v.yyynn ,   |{ $$'y(0 $ `~ |~{yp~  |}}  s s w,}} ~ eee1~~~~~~~~~~ ~~~~~~~~~ ~~~~5~~~~~~~~~!~}} }} xy =5|%$t}4)%h  xk /usr/csbmb/src/TclTk/tk8.0/generictkButton.ctkInt.hǟtkButton.hDP$  $  $  $  94~~~5Ww~,`i)wyxw  y1 %~ %~ !      ~5  rr   m  b  u % t& c  f%Pp$)#~ z\O1 xq     9$  9~  }} wz `    % b ,        vx ~8Xs-~<% ?  x v ) y) M!- d 2  vhv y  %U &d f %  p~!~~&v   } l x5u%$  -zzk~zj  q|* v -$~  g)   =| }$F /usr/csbmb/src/TclTk/tk8.0/generictkImage.cϾߴ~    51  ~1{-~  z U~~x  91  9- 91  5-~% ~1@1I1 {-   ow1&_-) }$-QC{  z z. &{{o%~~~-~!~ !}$xz w v{ q{~zf5|%!{ }}  {~{|}~f /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkGet.cጒmlocale_attr.h춲8  /P z  ~  ~@ ]  p :  v{| {| p45#}~~ {| {| p45${~~ {| {| p5&0#{~~  %}0#| }y45z vnh-8y<5_%j+| }y45 vke- H~u85~~z|] @~<~@~D /usr/csbmb/src/TclTk/tk8.0/unixtkUnixXId.cŝu~~~~y x zxt w  i "yyy   !b9      }  |Th /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkBind.cŞlocale_attr.h춲Ɛ /~}gU~I~$}}x0.}   u  @ y~ jzz}(%$}~{P ~~}] ~. ! ~ ~Kk)x{!{$z!   ux!~  e x~v  X82N2N '{~}|   a#*   w ww  ! } r mvs  M   %T,  o  Sx u u  y   ({}{}@rq}}!l~~  1^!N ~~ v {{} } k  z||| _~~~  E,X 5r;S %~=~|~  !{{ !+X{z u -4~ }z<# w t ~!       !!~ $ $~     ! G* s {(( %!}||*-  X { x}*Z5 )15    5 9 W   `5    l$ &{( }~ -q. w   xx  $~~ guy  # %^"^"B  u   ~ \ a   n&W 6 yy  )!D}){ { , +   -% ~f-|o1 =_!|{}}~~  * q  u  u  u w  u  0}Z   )        &    %~ ($  W-$   ~$p-( }$  *  ) $p--~   %(~} }  9}( <    %f~! ;}-$(~ o`5~~11 1uw8h~i6ab g6p?||| x x x 5!3 d } d | { 4@ p ~!~|z~z  M7~~ qqq =~zv z~& &"a~.4  _qq ~~ ~    zxj i~~- }rrr w  ~- ||j "wR%1 5 !(5 D~~Q   t  t  <' s   )G     "u y[=  || u^    x   w-t%1~t b   w  ! $v    | C /usr/csbmb/src/TclTk/tk8.0/unixtkUnix3d.ch `, )-} ~ g  }9U h x :~ {  '~~|~~ xpx /V~-~~)) mx 7v ~!`~~0,&j| | z |p~ iE /usr/csbmb/src/TclTk/tk8.0/generictkColor.c鍔V*{{x ~~   u} |,{}~[~r{{x w }~~%0~}~~{]7-5!  x   ~ ~ ~ r #~ 7F /usr/csbmb/src/TclTk/tk8.0/unixtkUnixColor.c鍔f0@q )~  y--~ ~-As$o)~ wz ! }~~~ } # { ,i$~~~~~~||~~|||~~t~~ |||~t tt ~||~t tt %~~~~~| t t Y~lL%~~b)~~~~~|t~ $  s  z}. /usr/csbmb/src/TclTk/tk8.0/generic/usr/csbmb/src/TclTk/tk8.0/bitmapstkBitmap.cߞerror.bmpҟgray12.bmpҟgray25.bmpҟgray50.bmpҟgray75.bmpҟhourglass.bmpҟinfo.bmpҟquesthead.bmpҟquestion.bmpҟwarning.bmpҟ:}|| y}v +U+  -$}    w~~w( 7E ~~~} v1y ({ t)'{  s)% vy  % ~!  x!* p($~E55559599 $  /usr/csbmb/src/TclTk/tk8.0/unix/usr/include/usr/csbmb/src/TclTk/tk8.0/generictkUnixSend.clocale_attr.h춲tkInt.hǟE  }~  vx    %H &o  { {   u41)~ w$# | |   e,1& iv v vR6~{ ${{$ -~}y!!zj!#pp R .)! . u & m  &x u ~(qpq  ,ev~|}}~} %   )s   . ."4 (! i R3%7   $ji  -{vf(~}} +#9 G+ )0$ $ i~~y ~~l  1   l5 l~au ll  )  ~1  %! ~ {) ~   j !%~,= t    R6~[41$   b $x) ~}m-  ^!o   }  5)~{} z}{ y~       % =7 p   95   B > A9-~5~ i  b  uT~n )~~F }}  }}~A )~~ ~      y }-5  {   v v)~~m+{~ tx{# 4+| (+  iD /usr/csbmb/src/TclTk/tk8.0/generictkAtom.cጒ0q{{   ~)~~t*|| -~}!-%~{h0|  !s! W /usr/csbmb/src/TclTk/tk8.0/generictkEvent.cጒtkInt.hǟwprqqz{ re!~ up u   q-  }~~~ }*(  o0  Sw i~}n~ng  -!       ~~   zA_Wz   e V}x*z tp2}}!  ox %|  u    ~!!j\<<}|| |{%z o+ |,( wV /usr/csbmb/src/TclTk/tk8.0/generictkGrab.ctkInt.hǟpzz w   < P0 i 1  - 2~1 L1-      51X \$~~ Y [ ~   U~!_1{ ||y t%~  s:|x z%%S : k"  t w*{  zzz    ,~z !%t *  v|r  xv >B::1~ +hm !!_d ~}~  g  )  w :  ~5||f|b$}(~9ff "A"  H#~ ~ | y  } D'$_ ~0  ||g$ Nw  z~~%~t t t u ~~n+  r%'{~,E$ r  |w)}}!~~$q)i~}  *sexu ? txz,|{ yz /usr/csbmb/src/TclTk/tk8.0/unix/usr/csbmb/src/TclTk/tk8.0/generictkUnixEvent.c_tkInt.hǟ8} --~}!~  $ < un)  H~wn)) ~q (  #z x w ~w%    {@ } u~D N| 4$~#g /usr/csbmb/src/TclTk/tk8.0/unix/usr/includetkUnixWm.cȟ locale_attr.h춲P}$ay'pV6t u } v|~ $z $-  -~%=yyX%)bx+  u u   ~{    ~ !!%i=D9 y}yy  w )9+/1x5x x9,1x,    ,   91 &r1  != ,  % !(   ,   ,5 ,  #   y%" /0   $ 1   ,5x51~ x}  0   0  0  01 ,  ,  0~ y -y} ,z z ~|z !%~---{ %$ w $--y  ~}8 ,4 -{1!~~~5 11{  ~}~m y ( 1y ,  5y ~.~E$$  y"~9-{-~~ (!{)!$ |9}%5(,~,~{ ~ !}  R }|!~  },   z~w-{ yyu    (~~}{r,%!)!$ }%1~} 4,k | !}! +(}$) l}1  ,   v)r ~s 6L)1W# ~~~}}v~S/nc5 $bq|{z \qp!$ z|~~}}h !~   l  W!!)  ~ Hc  fo~nm~  &o | )~{ y  u- xw 5  ~w  }}-- L#]'|T|+T|||{ DI  }~ v$$(a5~|  w t &zzz {  || *  ~ p  ) )   x U&% C~%~{~ 1 %%% s  u%xxW  |  )   %vu %{s~}}w% y| {-~~(|r  ' 2 %! go   ! , s }hhl-0 ~}* xx  }    ~|{~O   4  - *.(\ v v R )-~y$ s s s  }s s } -  !9*{ }~k ~  | p ! M ,  t  1-! }d0(; w w w )p-*~~~}~ t t 9py <s s( $ $xx  v   ~ g !$    p wxn 9- }}} } }|}}}}}}|}|}}}}}}||}}}|}||w   {1$)~y  1  cewuck }}}}}}}}}   (x$ } ( %)!gwc6on     (s vx$ w%!G  - w w w Qy ' v i  (~}zu (z) u qy z~~  5\a ~#  $  }}~I%%,- W $q* ~},{}y$|}I /usr/csbmb/src/TclTk/tk8.0/generictkGeometry.cጒ&.rrrr! v v $  %} }~}~  $ ~)nnnp)ms |  lk  |~{ )   #%![w| xd  || ~#z y y  %q~~}&pppr&oq oB /usr/csbmb/src/TclTk/tk8.0/generictkGC.cጒO0 ~~~~~~~~~{~~~~~~~{~{~{~{~{~{~~~~ x $~S~ ~r, uy 4 ~  [V /usr/csbmb/src/TclTk/tk8.0/generictkCmds.ctkInt.hǟ6 7 1 01 x1 x  |%S9 `|21O  ev% M1Z~ " 1~} ]9fp$ ! p , N  ~!||0r( y-} 5 1 =x1q+5 1 =x1q) v v {{(9L| ~~~~~xq4%X {( ||||||w o 4 1 q- 1BE    1)O~~! a! ;b|{~~{ 811 |y}~  V7I7I=~~~~{( u( }~ { %}   ~  5  $  -  -  !!%$9 k  $ $ $0- x 1 , , , ,     5 ( 5(5)5(5($( ((( {  -}(} ~   ) ) )~$ (' $} (()!~ ~!t s( }- ~  ('   1Q   A-{( )pw1%~}E /usr/csbmb/src/TclTk/tk8.0/generictkGrid.cѝip w  " > ~{1 {50t |    91  " 5   5  9  ~   ' ` <}$)~{   n$  !~ %     ~ % f w   |$  s% t ~5 [ F}! 5|~%~}~!-9 )~,~ $    |,~i | "- {~I,l,~-5~$ $  -5|~|4{~I~} }~~~ t$ly $ %}~~  w}(4  "|| 2 !} 2  }( ~( }}}~ |'w   z} wy J6" r 0~&~~~~~~9,s   ~ ~~~~~~ ~~~~5~~~5~~~IE~)~~~~~~~~  ~~!~~~ ~)~~z~|=~~z|=~~z|a~|~~|~~B >%5,~.~~~~~~9U < }|  | : | (|}{{ | (|}{{ | |}{{ ` } ~ | }x ~ ~y ~~5  =~|~~~1~~|~ |~~|( % ~(  y zs {{}%{z*x `x{}{|~4u u t%~~~%~  ;I7 tM~ )4 5 ~ ~ ~  lt   ~ UOg \  | #!   } | ~& ~}  ~}   ~}  ~   +   v   9 }  B  &  q,    |v  c(,~~ ~~.)~}~~~}~~~}~~~}~~~}~~~}~~N!~~~~~~~ V   sx q s   =80~~Dggx g'rg5 {   b) p  f  6~}r  )Z  krz  ) nz  )   }+~~|     #y=!  x|~yozy]=  ~~ ~ ~ ~( t   v  ~yQ~848 np'n~{ |~||*~*{ } yb#   's  |% O)$!~ ~  mq   g ceg~~qy6lllo1$ @ q  %!$                  wU !&   x    ~M   4kx 5!F  t   !!b=$)~$xz ~(~ %$Y v  ( ~y }5 ~( } v  v  ( } 5% ~1 1  1 G ( % ~ v Z1     1 U   ~y }{1{11_i /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkVisual.c|locale_attr.h춲w ppp <   `&z ` ry8~i   ^ x r"l "  "e!~   zz "z~ ~,@6|( qA(  A  .~Q $91 I } v v e z zy  g5y1g&~ v  0s q-" v   y(}{ !;F /usr/csbmb/src/TclTk/tk8.0/generictkFocus.c0 e   ~  1)h| 61`   b2(D2G1  1 )Y-p%wzjlll*jl* Y 9e 1$ {S$-~$$ x $ w    }}"x   0$Zo  x~ "  v}| !k~  o- $ &  w  w  y w  g/ O !}n  #~~  )%DG /usr/csbmb/src/TclTk/tk8.0/unixtkUnixEmbed.cǟ  ( =qq}   (  {|q$ | w |{o w v )% ~  u  5 ~# S   Y f $Z}1mh 9 !{{ 5) t   ~~ u   |   x| z#r}t%~  |}~}o+    ^!!|  $^ `0  u|   z |F /usr/csbmb/src/TclTk/tk8.0/unixtkUnixFocus.c0- $ % $P- )Z  hxE /usr/csbmb/src/TclTk/tk8.0/generictkPack.cጒ‹) /,5 ~5-1y 11 ~1 =1  5 &  -   51 ~r  -~}yG--O50H(0 ~r!| J z}5DW55~5}}}~ |[m ~     {{{{{{v{{{{{{ q ~ ~ ~  9{~g{lu|&|Y'"= x{} t  ~! q ~,~~ ~~~~~~%~w v $!w v y=!{~ |w }|e<:b&z z  w $ 5( ~q ~   :4h!~ ~   H) - - - % ~ ! ~ -     ~ v+~     ~ m\ !  x })~){ }|h!'s  "v  %D% )!!~| eq~}  @)  $~}}   ( , (       q  )~   }   ~1 x  } & x! ~] ~ %$- {' $ $$ 5  ~ ~}: A {b ?  v 1   U ;  % 4- {  , {y /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkMenu.c†locale_attr.h춲tkInt.hǟ1% }~}~kfb ~$) w xq5 F   Z   ~    ~ } }      ,*" }1 , ~  ~ }    } u  } kt t  d, ~ ~$-    ~e pp   pp   B"`  ; dy  ~ ~$    r ~    ~   {~ <  +f~   y~ ~ b }  } }k)  x ~   x ~    $  {~ U U\4~ ~  q  z p}!hy( z +i j     n  !   %k  %$g~,p   n}!/{{ h    U r,  } }     ~ }-[   |8}} | |   -   ! ||  V1 _n (  O ~ 4 s  ! ;$D9~Fs s!_ y  j! !~~q0  xyk~~!~ p# .u pp}0     ,  }~~`$ H z   u u  **z 1 ja))9t n ~!~~ v & J F N ~~ s npn{ N 9 )    k/F Y|1 (a=~ E ~1 ~ % 1 }~{"{{{  ~zb |${x5(  $95 {x  ~( )     u  })~1h {    F |  % |%~)  1} | {5| }J |{{(e0| {   | z w  v0   % !w  %n8 pi{{ 1O)~   ! ~  ~  |  |x} )   w  $   !  !A  { |~5}{!} z z i}!   |)}OZ /usr/csbmb/src/TclTk/tk8.0/generictkMenuDraw.ctkInt.hǟx6y' v 1  1 % u u  (~5~ ~!  _ h{  z ~zp!zq wz- !%%%M~ A'Sn  ~5, w~z"{  | r j- ~ w} w}  y }q {~ }l|  !!i z%, ~| xx~ v nl L1"  )   4L1(w z /usr/csbmb/src/TclTk/tk8.0/unix/usr/csbmb/src/TclTk/tk8.0/generictkUnixMenu.cĆtkInt.hǟP$   -!!   h   (   o}l  x} u' $~|%v   p{%   j!~~~~yyyy|:!}~~~~}}}%   F!izzzzzzz}2  "}1& |} }  y !] )n * {{{{{}   %~ #w  wm  wls~|s }~~|}}|} t}S(|~r('ee {~5!$|}}}}|}}}}||_({{!y|  wQ }~{!u u v~ 1z) }  9|t  } # 5~ z z z z     %} ! ~y |E @ p8u+  s5 1{{ qn%  || ||     ~(-z$- %}}{}d"-|| F-  P-?- z|s - z /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkText.cΜlocale_attr.h춲tkText.hp   5}~~}~} |~$~~drc:~$ 1<~~r5  9~ ~ !~  00- }5   | ~} s    :F:t t  a m    $(  ,   "$ * $ & $ & ( & 8 &   & $ & $ & ~  ?{   = ~~)%~~   w ~ ~  ( # !I)~} 0~=C5 h1/ 6j  u*-!  ~   q q8~R ~ 4 ~ ~ $~ S-s v  ~n t r  ~~ 1 ! ~(}} ~{ w z5-)kkk   }d1$< 1$!%Qkkkkkkkkkkkkkk~%,z $m  t   f   -[~ f ~! x  9$$a-1- -,l%(~~dyz~}I ~%$"   \  50$  e0o}~* 0i z ~   $0($~z ,9yx) i |   (b  ( s,   { z,  9  v v v$  g ig ,~  x(   ~ u ~ | y  ~&}{~   {~  x{~  ) 9!p ~ ~  |~ )   Q *~4 6!<~&~ -~z w x!~J~.~.~     }   =uk<<<   Ax    8 zl XE} p p )y{( y0 e$ /y j(~  T(#   ]( (' }}={{     ( ( i, z,   u  u } Y,qq |}y ~ ~~ %] !    |  y     d%~~$ |}} ! /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkTextDisp.cǟ locale_attr.h춲tkInt.hǟtkText.h|~ o~~ w v !!)!( c~~z%$ ~)(,)))))))))))) )  f ~!~4{R |5/ f(xy u u o|~ !~ ) , }}i $~},% y  ~)x!|   q}{}~v}%mxo~~x ~pT O a~  yy6-~ %~ % ~ s)o|~e|{   }z!~Fz!_!_!a1$Q ~  -\%-[~|  u~- a.%|z{~   } %$ vz t t v t   $      ||||~&}}&|_$~}l) g&}~y} i x  %Y.}y}lm  %_(  M@ x! x  ~zz   y N w  }5{  ~ uz o~}} #     5|l ql         J$ !}}}~9~~|}  } u u w   4 5 ! rq)! y$a {rr 6$L ~}  u x T@(}j   tw%zq !!}  ]a   t t u  % ,  C rt  (  ~)|)f$  ~u u  +U s~| )z)y($ u'1!,  %!~$ (}(   3 q 5     *j~j| d{9~{g(#||?A~(!${x~} (d~| 0-       %~ ,|e($p(- $  ~( , 0 %j\( ~ I)/ f $1-(%($ &,w1R  1~~~{~~A~ _q%{|~ !m,2y} y z|~ !g 0 *|){  ! s { jt w)  u h h v}  v  $$   4 tn ! ,, ~(|{| ~!xoo z*  ,,4$-/ jkkj x} {~~~~"^ s ~m~ y |   y} Dh"2X    w   L<||| .(|{{{  u  %~~m8 A ?Mt ?M  %As e \s ~   {5 |   ~  z  u %Nz M #~I%[ w  j t ~}oo 6cv [0}}{1  x |   z m 1 u  \*"^~ ~\ /usr/csbmb/src/TclTk/tk8.0/generictkTextBTree.ctkText.hU    ~~{z }~} ~ f z&!m v v k{b%X$]$x}0  !%k ,| ! ~ t p- q) r~~  )1 )"Q  vt ~* 1!Z gzy  ~~|~   b -   yw*} xxy  *| y 3~3~_- v  t ~   |{!h5}1!z" s s t. $ V~q  1 % z({{ ,rx    ,Y : #^ x h  n ~  w ~   }Ty   v | $~ }  &r~~Q v v v  |}}~}}~~!%oo~ }( u u u x|}} w $ !% rr~ ^   s~j    x!  rg  ;!w t t w   S- z i|o  kz" ~ ~ r r s r ,  ly    sm    ! w  ~v ~ },~}  ~}~{ {    ~ E})~@=  "| | | ~~!!_!~ r $]9H{(~  c9 ! u )HQ "}4dI  ed wyww  'Z  !~{ ~Z  b  ~>   v !)nzR "Tz  P|  ~~~~~    v k%~ K~h)~  ~~~~_9 4.  t  t)(  ty{  b  ~ 4 n  y{s ~{}} %-}$   $u u%(1 )  !f~ -5)  {! m  !4fI /usr/csbmb/src/TclTk/tk8.0/generictkTextMark.c  1  1})}!u ~  =1 91 51 c1 l } 1  0hT 9 K- t 0o azz   x~{ } a  | 8 )!!+{xono 8       |p/   A ~~q yy   s%l(%   y z  } %,!|nr(% rE /usr/csbmb/src/TclTk/tk8.0/unixtkUnixDraw.c&?{{{{{~} u u   |  vr %[v [#_  }!  /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkTextIndex.c᜝locale_attr.h춲tkText.h|y }   t {k0 6- v v v %5K   v $  1 ~l, ~xl* &~  ~ j$ 9I)~ !(1$-  X~)d!~  f4  |$-  ~!~~w|{#   r~o  S  , os o q L~9  (xc$<  )j!|u|r < v v }   B > ^ "` w N    ~u xx  w| ' 1w  zUx#t V[ /usr/csbmb/src/TclTk/tk8.0/generictkTextWind.ctkText.h $      0  01  1 09"   c  (  z~nq~o  1-)9 Q-}zzz{    ~| y ! --) %<} !!~{u!+x ~z  9$||{||11w% ) - n !+  v vd }}-p%E(%~~| t $% %1-{+{{l 5  ~n!% W #}} ~-| ~~ }w $})}\ /usr/csbmb/src/TclTk/tk8.0/generictkTextImage.ctkText.h $      0  01  1 09"   c (  x~nq~o  --)9 Q-} u u     ~  (!f 5} !!~{u!+x ~z"  !m |!+  % d t }|}sp31-{+{{{ =o;||M }w$(!)}||{ Z /usr/csbmb/src/TclTk/tk8.0/generictkTextTag.c엩tkText.h  :( A? ` z1 {5) .( y (  |  -    !(  & (   ( 6%  ( Z5{ r    V0| $   , } !(c }!Z%   } 1~~}H1}~ 1$ 5~ {%   $ ~! ~ ~ ) !~~}%C -%} %}X% { 1$1 ~)|- )~) ~~)k} ) )N}) $  p x}) s~)  }) ) %}q ~  mm1 }l mmmmmmmmmmmmmm~{% x_"~P }%} 9 %(z o>$0,} w v w@}-|@              l0    , v v   z|  | y ( ~n+ yy %[ %S   -x~ ^ {~ }|`  \${~}|` s p}} t v  )$  {@ u x  !1$)A`l"(i /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkImgPPM.c𗩘Ylocale_attr.h춲`}%zzzz |||{q  }{~x }_5j ~yt .& l B$    }f5 y1   $ y!~(){~} % Vzv v v ~!Y   ~ *  s (m{    t  {Y)X3z( ~  y~C{ /usr/csbmb/src/TclTk/tk8.0/unix/usr/csbmb/src/TclTk/tk8.0/generictkUnixButton.cptkInt.hǟ5   qqqx) (  %~ 1~  }}||  !  5 !   (~1c ~  !~ ~} v L~~ }}51   Q%( }}   ~C ]    '~|1Jpr! !$1b* )%9D /usr/csbmb/src/TclTk/tk8.0/generictkUtil.cR(1~bb|~~aa# $# h1 f o   $l )$ |!1j }-_qrs x!(}!(I, u { J /usr/csbmb/src/TclTk/tk8.0/generictkClipboard.cጒ/; {  t | t/ ~}  ~~}t    {{{}}!~~$~~   v} \)-,!~~)~   |}~|y~J ,pb1 )~ ~ ~ 4L 4( || u 19= ~r1  -51   -nP"~@ 9 ~s5  f5%~u w|{ t  w  q  G /usr/csbmb/src/TclTk/tk8.0/generictkSelect.cጒ=  y{$-{  w yx|~qh   vq v    sr-  }%%~|{    rt}l w  L*VX~yzy  v  jyj%~!~%~   s b8    xh   c my@#  | | | ,T ,?)} }  ~n|{| $ - ~~,u d  )%)L1 ~D +) 9},1!h sI~ ~q ||| 0 3~n |||$ 5|0 ~n |||$ 5|(   !  1~ ~1 21 >1 9 1 /1 f1 Y S*Ev} A6~5;9-w~*  rt yz   q q q |l    op~|e ||0~~m~| w u u <!cpu~~[  D)"~~c  q!)z~$l%~ 3 /usr/csbmb/src/TclTk/tk8.0/unix/usr/include/usr/csbmb/src/TclTk/tk8.0/generictkUnixSelect.cጒlocale_attr.h춲tkSelect.hጒ6_} u u uu j    x ~|KA,v ^  ,  . {)!~ v~   dX <~!~ q &&x $^  Vy    !~)  Xow ~  !~ i)<   )!  s s s  rs  ~~~~~~~~!~   }!|wz {V~w u ~u   n ep.~ }~~~  $ t1 -- n~ ~~{ ^)/J  {$e   )  ~  )zx}{%}}}} %nnn ~ z   h1 |!m Y s t ~} fd~k~ j$ 'F /usr/csbmb/src/TclTk/tk8.0/generictkCursor.cጒVy } ~~}~l y~w,} w  ~~~dW~ H1%zz(~v  wy  zG /usr/csbmb/src/TclTk/tk8.0/unixtkUnixCursor.cǕ\` { | w ~~mm  | -  U > ~    >B >B >B >B >B >B >{~F X-O    E9~  ~zjt  5l-~~~n~ h919:z|}zz} }! ~~ j /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkCanvas.clocale_attr.h춲` 5 }~~}~;~}}j8 ~{$ 1 {5 ||| $  /  &($ x5  ! 0j$  x  x  x.        y   y 7I}  z2g  { %[-}} $  |R `1  }  }  }( "  } ~(~~ 1        w  &\ 0k|T } x||     z  {  |  } _}y y x y -}}   )}}6~  x| x 1   wqzy }}}=%-)yy 6x  }{A  z  %-cQ~|9| w s}}}}(| ~  ~  y }-61}  )X$  x~Z(b}yyy|1x z { |1 ~~~ z  x y%) | | |  z  ~$! y%yV =)1)yy~  ~9 | A,| Q ~ } } ~ ~ }} } ~ ~ }}w=   %-l}  z{%    } z -~&  g  <{  ||  ~  " w   l~{ ~ ~  }% -}z,1~)~ t z  x~s })} }  ~} x x y~!((|||! }~z  }|~-~zzzz$ zz { ~!~ z~~}{ {   ~ ~~~)~ n &  t  j{~ oo ry y ~T !   W~~~  yyy  3~!~~  i|   1" ~w~s *)~ ~ z.t t t! p| yo {+ y~p; v' y~t~4 ~~~~bx$ :    55 ~ 9" ~ =!5  1 95 $ =5 9  r1t~p9   %  ~~}~~~~ x}, v1 t1  x$" $ v$ ~ ~ | { {A "  t  u   !ggg x~t%}}    }  x~G"B:F2Ru }up&Z s$195K5R } x  q q O1u Z& $~~$ %C {?z}~ }~{ ) { " u %~ 8.J F N Y{*^ '  uw-~ p z{|z| g}= ~{  ~5{& tttz}|( s } zz{  )-   Z E-%  -| |}}}}|      u    t! !CI /usr/csbmb/src/TclTk/tk8.0/generictkRectOval.cጒ  m x A4- v  q o0$$   yt  ~~!wng=   )'Y+v_$f t whmzzq|pugmm  u} z q z q (v v v v }    +~v t *v^}px{s }}t~V={zu#||~|zzzz s  sx0w w ~ ~p~}~k~~~}~}~vxxx m"|{z{|}|{z|~~||%{  {    $)!b% !a-  E /usr/csbmb/src/TclTk/tk8.0/generictkTrig.cہ`5 qqqz!!8Qxn-~h{ 4)~Ezza}q `r ?L  t    g0 r "  ~t ~ {x } }~~j n&u w  mk(}$ !lnFel:I}!#`x#e v-;]~qb4i{  ~~! qq }}-o   o : u u v u u )gtd sd+qt t ~ y{1   t t ~}~` sr~p}s} zhtz! !s}--! yyyy  y]~ w w] w wM~ {]2qo~  sx u|!< ,[  w   G$ h!h k r  !~l-$~{xi~x~-"}ohs   &ll~}}}} |~~~- xv -~~}~|~{~]y{{{{{ {{ %pI /usr/csbmb/src/TclTk/tk8.0/generictkCanvWind.c"@ ~ o }A4-y %w w0  "{ z    z y v 1!j c%!!~%%}}~&tf|J ~ H||9" }}}~)}}|{y{w ~~|z~ q w  w  z#z}z|}% }|~~~}9%~~  l /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkCanvLine.clocale_attr.h춲.Pkyw|{|{z : B {88 D  c }!= 2 ) j Y~~yyx  %%I yk z}%  ~}xx!$ } G    z t n t  s  t  %~~~}}}  ~~~~~~~~ ~~~~~~~~~  V[{{{ ?~%{-~~~~    (-mP  uu~ $ ~ | o ~  | }x  }~~h d { , t w"   !!J434 o u { 4 {   {2 i ~    !~o a  x * ${ }  }% {{ {}~   | |) !!x u  u  u|.~~ xwk1N ~q s~huy}}}|~|~~   ( |~{}{}|zw|~~ a}N~$  } ( ~||,  -B w' d +  ) -) !  %%H /usr/csbmb/src/TclTk/tk8.0/generictkCanvImg.cጒU ~ p}@4-y %w w0   {  }% |||{ kxN ~~)9I}|{y{u ~x~ q w  w  z ||}~~}|~~$ xt 'H /usr/csbmb/src/TclTk/tk8.0/generictkCanvUtil.cጒN_@*#|||~~}~~ u}|~~}~~}z'|||~~}~~ u}|~~}~~}z$)~~%}) v v   4q4&J F N}}/{}! xI /usr/csbmb/src/TclTk/tk8.0/generictkCanvText.cߜe~}~h}@4-y %w w0    w v  ! w ! x }$p%J~  !%!|  nw "p   w Q4 y $c~$  $1E ~-x -     ~ &@$u$q $~ z~ y $  %(Z| vv vv (,  !%!~~y$ |||$|| |#||}~~}|~~${yx%    s{ 1b  } |R], (  q e z zz+{{{w w w ! # ,!()$M!   y  * u.#t#"#"#"j /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkCanvPs.clocale_attr.h춲`c L%vl~}~}L%[4l   ~ } %| }  }  } } N Dw ~ ~  }   j$ ~]  , u  ~  ~  ~  ~ " i $    ~ ~ 5 (1" x -19  %||  (  '#  1 {*  )0)%, 0 + $  (%) u $ g5$~~!~   $ ~= !~rr=$%$ Y){9){  $~~~t<  I~}8|!k-|~$ , !   $$5! -M~-| | }z}| ~z vi145a#b'x ~  ( R-ErA WI /usr/csbmb/src/TclTk/tk8.0/generictkCanvBmap.cጒ͵  o }@4-y %w w0   yt)~u%  ) |||{ jxM ~~) p~|y~|  - }|{y{u ~x~ q w  w  z"||}~~}|~~! ) !z!!!r   ||||E5  x t O$, ^ D%$$$$2   1$'#'#)))  mF /usr/csbmb/src/TclTk/tk8.0/generictkFrame.c      #6 *W)  )    ~pl~~ 5 ~z5 ~z  9 ~  m ~~k=1  }~}~| ~}|mnmcc)%v!  u   - (  711   }o5 - fzm r r rr1^   \w }}$ 0 {|   wwr  {{{{ z#Y.uy  %C6 H%  5  x #~~!! ~ v  IF /usr/csbmb/src/TclTk/tk8.0/generictkPlace.cጒ` %~ w  :15  ~5q1l, ! =  55  5az-  --(,$ ,1 !},! !},)x(- 3A }~y{yy yy9||~o$1~}|#zzz  ,%~~~~  ~    u  4         ~1  = # ' ~%% Q   )F   { 4%!  ' }  9cP K^! Q- zt  ! zvy yy y ~ wx ~~~~~~~~~l~~ %|%f'Z&q|  ~ #M x~I~x v %W~ %  { 5 z0)x!D /usr/csbmb/src/TclTk/tk8.0/generictkArgv.cY۰i0t ~~ s zx$   # +  =r~~~~~1 | t s}|~| | sr }    (E~~ ~~~%)   $  1 \  ~-   !yr 0H  n( |\} k(e/ zM3 KH /usr/csbmb/src/TclTk/tk8.0/generictkCanvArc.c0 ~t ^  <4M 1  v  q o0$$   x w {{m z~!~~~W}x    )  } ~$ ~~|~~~|~~|~~~, ~-}Jv v v v xx  1 }e ]) 5  { ~- l 5s $(pppnp~~1~ha  x} )~   ))  }!~)1 N$- %$im|l|n|~}g*sd t~ w~c*V,w~ z~~~{~z~~ u!B   11 t- ~ u  k1 m1 *!45 g~ x(8|{z{|}|{z|~~||  }h$~F%j\%k[<D:F%[<|}~P-}~ c"}A~~~}~-~ p},q%y@& p},q%y@#|$-~}~- "  }# 4 $ !S}  $$)*-"1)@ $!)X ( )  %q!$W /usr/csbmb/src/TclTk/tk8.0/generictkScale.ctkInt.hǟ  9! }~w v ~1az~}t~*bb$ {1 -~ %~ ! 1  1 t 5   ee(  Cq( 8 Vq &p $  %~1U '`"^"b j0 x } |~%~:10.Y&     ($ 9    ~      z~~~K-i9yyx!~-yyy r /v vpn t t2~))H~n   < u }yzy~)  w  %~  rr{1) f~,|  %h` !s  )~!~~z  !  }x|   p 5)~  q!{ /usr/csbmb/src/TclTk/tk8.0/unix/usr/csbmb/src/TclTk/tk8.0/generictkUnixScale.cጒtkInt.hǟ )1    ~  )|ppx ~~{|||}~ ~~!x A]1z{$ s {sxx {{~}~ }  )|pp x ~~~{|||}&%x @]  z{! y~y~y{{~~}~  }  %"^ i   $ { + }~  {{{~t  ~~ tv{{ #} ||~ w z%q)zz z -{~~su~~7|||z  rA /usr/csbmb/src/TclTk/tk8.0/unixtkUnix.cʖ <`,} }! -1~6s /usr/csbmb/src/TclTk/tk8.0/generictkMenubutton.ctkInt.hǟtkMenubutton.h< =PA ~~ }~~ ~ "h~`!^(~ z1o(  [5   } l   } z /     ($     }} z   a 5$    ) vx b- 9 x v )~ 1~} w-~  g   vhvy  %U &d pm! f5~!~~ v -$~  g)   =|l{ /usr/csbmb/src/TclTk/tk8.0/unix/usr/csbmb/src/TclTk/tk8.0/generictkUnixMenubu.cBtkInt.hǟ N.   { uu ux ~!  -~~ %~{ {  (vA ^! ) 5}}10$~-S-d  -H /usr/csbmb/src/TclTk/tk8.0/generictkMessage.c V0 5}~~}~~he$ {M14   w  ) ~ ~ } 1a1  }{* w  ($ 9v55  ~|h,x%~ o  h {z sv m |~}  ~4c<6{{{{  5 _nry  %[ ` ) k~!~~ v -}  f) $H /usr/csbmb/src/TclTk/tk8.0/generictkListbox.cơ f 5 }~~}~-~f(W*S.$1 {1  A~ I~ $ .   9 /-   |5  7- S 0g'b  ~ ~(  | s  |j  }.\ hh  }o~  g(  }qq  ~ v  ~/V} 0g |~~ |~~   ~~    }  }  H(   ~ Y } g}|0 } }}~ /~ |   ~ R~(  }}}}~    }  x ~~   (-, ~-)~~~ }   )~ -~ ~  ~ ~~}   ~ ~ ~~~~| }oz~  ~  } x x   ((|||  s |  p(xxx -- y  v t t t )  9~~ ~zz yz  s t~ ] @&}}~~& |}~}~|   ! (xYp |%~1y!~% w ~~ $ p  y|  o}{~! r$ w z!,0C${ s s s v   r!l ox! x! ,r y 9* )W%jS!"tkyz|~y  [~!   | (tpp Y'Y}  rf,  j=~ = ~ , 6-{$$ xp~~mppqqqq $zq0-~y~,tyy~ } }| ${ 1{{ e> "  4z % u{ {}}W, 1 (y v! b3y t"! `E /usr/csbmb/src/TclTk/tk8.0/generictkError.cJ   w x~}~ox9l c~! )t w   ! q { \l /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkCanvPoly.clocale_attr.h춲 ldd d u  * B  z9~8 P n }5 2  w v ) m _8~(  yt   {~}|! w~ en'    ) z ~z ~ } ~ !~~~ # !   v  j 5  ~    -zq^  ~}-|wxt < ~   !%b |L{{ {}  {{ {} ! (   ()~^ -s%` k /usr/csbmb/src/TclTk/tk8.0/generic/usr/includetkImgBmap.clocale_attr.h춲  }}}~~  v t |1|  v    |%  9T +n ! ~ () p x)!u |yi     P 0P1 f!{ ~ (-)-  iI$!= :! \~   ~ U${}" w n e =oo e {}|~@ w_ !/ ( eA}zx-}#  w    } 1_  }{/  w  w   ~ w ~w  ` #1-uv-||    ~$  , r(}}9|~|` /usr/csbmb/src/TclTk/tk8.0/generictkScrollbar.ctkScrollbar.h鍔7  A ~~ }~~#z}~ ]#{kkzC1? U~ %~  !   ~1  ( Ujs~ d  ~s s  h  ~!c  p  o Lq 05 ~ ($$  ~~16~ { !~~   4~$ y~~  x ~/, J~ {$   {K !`10.3 y}})  (! f95|i}%V!g%)o;~!~~9z$?G /usr/csbmb/src/TclTk/tk8.0/unixtkUnixScrlbr.cǕl 0? |~}~o~  %(z 1}~~   ~,!#O$}w -    u~c jj }}  (Lz2  !{{)%| ,r wqz~n {?D /usr/csbmb/src/TclTk/tk8.0/generictkMain.cQ y t !,$ ( oo   9%!~r  3z w w 0    s v  s()% !M){{!j!g #x$d - G /usr/csbmb/src/TclTk/tk8.0/generictkImgGIF.cȟ $%  w w w  ~w }$ {{{{9f5 ~|z~  ,8H lm~!s0  "} ~1y) 2,~) [$0~0$(} $# } },$$yzx x ||j%9%w}%$}z  } v v   ||U!~~~lrd~dV-o||xzi|L1 #b.!_ {{~~|~$,~~~~~~~~~ v ."*~~|%5 pn } R9y,  ~  ,~~~~~~~~~R|||  n  (  v v yNg}}{{z{#~| /7'  ~ ~xxyy vkvxw%  f)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?)?8 1 eW /usr/csbmb/src/TclTk/tk8.0/generictkEntry.ctkInt.hǟ  5 }~~}~}5kc~~0k~k$1 {1 -~ %~  *  -  $}1 ( zz{~ $~  ~ } q   }t t  m   z   ~ c pp  ~~  u   =~~ Q  ~   ~  Y a( } [, {~ z$ .~  v   ~$  ~~ i   y   g   ~- }~,}  x; ~~ ; ~  ~~{   y~}> x 1}}}~~} } t~ ~   ~%,  * ~%  z  ~~~{_  x~-- y ww w w mw mlld d d !% j s s    $ ~1B!  O)$m    |!}}} ,}-1~~~~58Y%B ||  $ u u $^:|| $$ t t %!{ I k  | n!&| szj %v r {$ #~!~~!}pdkD< 1  -e]#   wzt 3Zz}|~  w z x~yza =p }"  ~- s "|{  q|j.$,)!  ||x% w }  v  ~(%i)   /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclListObj.cɟlocale_attr.h춲tclInt.hß @{ ~2~~~} l  }}})~2 ~~~}_4 =# -~1s#    }~~ yyyS5{  |%s5) 53 y{z~~yy ~ ~~~~~x ~ 2 ~  ~ ~ ?~-{  ~~~  ~2~~~}}  ~ ~~~~mQ  7( | ~~|~~  $|  ~. ~~~||{~w$ 1">"*84~4~4~ 4~P  ~  5 1  ]~ v s_(*}} J ~ |~~&\"$~lD~~  | | |I~~0 ~|} } wh*E /usr/csbmb/src/TclTk/tcl8.0/generictclIO.cˆ  c   }~v# v}|y   tx u u u ,TkD I   9z~ "{ { {  x  ~     G yy x *  5  q%x%   'Z ! q   Q q  w ~  ~  ~   )    v v v  t   I %  ~},$        r -r  { V !| 1p|!0 } $*w~}~~njio(X4 } } n !w z zz     ~| y   v |n  n.    ? 0 3 yyy {        p  g% q{ x    t          v ~   v       )   ~ y z   } ~ -  ~ t    s  m2i  ~{~x q#  k { $  e` x xw v x~ xw v x~x{= c~H~~ ~ ~~~~~~~~~ ~~~~~~~~~ ~~~~~~~~y~~~ c,M ~~)~~~~~ .u   n{ } )~ q e :~|{ .~  !"s s ,      q  Ox x~u/f{|z $   $      qz - s     ~~~   ~ ~  ~  ~ ~ ~ ~ ~ ~ ~ ~ ~  ~ ~ ~ ~ ~ ~ ~ ~ ~  ~ ~ ~ ~ ~ ~ ~ ~y ~ ~ ~ ~ ~{i ~  w y   R{,z =~ax b'l'E~p ~ ~ ~Q  z zz  , Y(:an $|X||} ||}L  kz ~    *  ~,T   w    r  l \l  k      s% r  ('& ' j |5  { } jy 'pp ~  ~  2  $   r.pp ~ , !~  2 2 $  r)    w  s~~~    P+w%     j,           - |w x  ~v   !R  u  v. %    u   u ) i   ~ 1    $\, ) `            ) |  o Z  , @9 |||      w   y"( y t  ) &0$( ! .+  ~   ~   a    "^ " |(   ~)      ~   )  % !  s        % !      "|  f v Q    n   w :  | ,+%1  %   ~ 10    - 0  a )  ~ (  0 ~ ! , { { {      N z             F $ B $    -}  H *$~   Z~} f f   (- x ~  }  x x   q    {{$ ~ ~    t   {!   x uw|$z  n %~#  t  }t     [ }5  u  }u      p{    ~      }   1   } }    | v~%}$trw~  ({ )! 5  $ -)M5y 0  {  ( (  2e s p q 5   }1|~       v        #}~{ ]    ~ 1 %  % %* % % %      %  6  }  }  ~  9!!!      $   ~    , 4 5 0 5P2 E$$  ( ~  2}~  ~~~  %    ~     ~-  j m p-  g   1z5 a!. 919q ! { "   +   1 1* 1- }     {$  ,   %    ) )   -(1q1      |xy  xyzJ iU M x u ~ u ~$  }~   !!~2 q%U $ !}7 $ %     -]    /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclObj.cŞlocale_attr.h춲tclInt.hßerrno.h춲 } %   $  1 uw5   ~ } s ! }!x$)  *}zz     ~$|z  w x y"(  ~v~)v}4 1 |,|~{   )v#~H$  ,,{,&,,}y   ( xD= b  s, $|       e$ $ ( $   |y' |}{   )v#  ~   w e f sb !  <9 |~|~/|~{ )~v( 5!$  v z})psp89 a |~X$ ^  ^4 6|~1|~{   )~v#  ~)'xx~)m /usr/csbmb/src/TclTk/tcl8.0/unix/usr/include/usr/include/systclUnixChan.cŝƬerrno.h춲termios.h۶| 8;;6G ~~|1  w | ~ ~| ~ ~ ~}z  t $| |y#w w w w ~}{ u9  }$ "    {$4||}~}{{"|~   w }} .%A- { t~~~~~{{6{{ } wy o   | $ywy !~!yq !{|}}     5  #  %  |  - z   ~/|}~} r ~ t3  }}  }  l,  z{  t  z |o% 3|{ ! )~  u~   u  v!{z !|  s nnn " {  } ( X(&    ,! 1$   0! 1$U Z  -  l 9 ~#x~    " /Q /    ~"!~ &y   e W  ||} e  f z y zz1xx)~}-~~{ }|{}|-~~{{ } Ay$)~~ u  ~ !y||{}}|  c7zz z  u($ k |y lz  { p y x    t $ %~ ~ ~  yn- T!- d-z)}}}(}~~ ~~Ep} { j{}~ D \ v~6{ /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclIOUtil.cSlocale_attr.h춲errno.h춲 $9 u t tr t | t } h v  =  {!   S0   b~ !  !            T,p      y ~  1 |J$     -  q-"} k /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclTimer.cˆlocale_attr.h춲 - wx$ - z  t~ v~ }  x !B Q $  r  k  zx   }} !m !* (r |f] }|ww' | |  y|~  kk|5~varrr A}!8~~   A}}~}~ i,   $ )0{ (? 8|}~~  k} @ p( &  -J%x{& $}~~~!  ~~$ y}X /usr/csbmb/src/TclTk/tcl8.0/generictclVar.ctclInt.hß @f#]#]~g%[}       ~ iT5~ a q I~  w<}$)~    !1 q~ t ~ ~ 4 E$}}t1; k~~z. -n-~z")- n <  &M~, ~w$1('Y'%~ ~=L ~~  }}}8|q - ~~-  !r s}~}} w } l t( "  w   |b   }e 5qq|  {y){yB /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclCompile.cßstdio.h춲olocale_attr.h춲tclInt.hßtclCompile.h箟  }| 1} H  5 ~ ~}  ~} }  ~} }  ~} Y ~u $%   w tJ.  u) p$  }|w5*  ~}|}}}}}}}Y}$ $ $ $  P ~~| ((V" .`$ $ $ h2*%~e ~)}} |!v H||u6   D|   U[ s$_$ <~}^<~}(% ^% =$gg.k( }.n$i.}.z .w .t.qz :||| ~ }  ~~<~r), sq u u v v w 5~!n   " (.  .  ~{1 z e& 9  k4~~A W zz p 1   wx v|{#~}v }~~}{ wo~iy !"r  zy}||r 5} @  5 ~ ~}  ~} }  ~} }  ~} U ~]~~~~~x W)jk  } q h z )}}  xv ^` xzxzm    "  t t   ~x t w|~- w| ~z vxy|1 v w~ |~y w|{ w|~{~ `~x w|| w|~{~~cX  &"\ /Q _  w ( *Vmt t } +$4~2,2  ~   ~~/G'/~ ~5E)}~||~ s |f h I }%{{~}z#nn v  -U 1   6} x} O}     - % 1~ P~~|~A~  ~~  9G(}~ $8+$~~  }    B*j ) %  ~   = ~    o o 1 zv   M #l4q z b q"^ ( q ~  ~  , /}Vrs  w "~}~ $       ym~ w n y y ~ xL!|(]~% |fo- pA~g yg nx$,   yl~ w}m yy\!~ " %~  ~ , r  H%[%[%d-1$,g] 2~!|wE ~~%%|~}~L1 q ufs}uq~!~qE   ~ t yjy ,~!~ ,Q!~~* m  u% *%[ } `  ,  7I q7n  Y ~  w {   V""/~)~~x2~ ~1 }~~ y Y~5~3~~~~,~w~~~z\,"   r %~zH5 ]"0 w  z5$$%    *#] |]#] p# y4|  ~~ 5~~,}}~ |~~ %  "$ { 1~~~~-#|||A=Ay)  ~   } #gi q% !} w  z5$$%   % g"^" yr ^ "4  x  }}~| ~ 7g, E  ~~su v% ~% t }w ~( }zz}~&s xr|}~}E   ^ *4!*}! Ay~~*|~~~  s  lkk,  }}~x}  ~~}~z  f~~    t  t 4 $Z+ { {4{{ }   $ xx yyyy-M !7 8 0  e l  _ 0P8 0 0 ~ ~|~~~| x }8     *  ~  ~ ~       ) =}~x ~ u S}}~ . w ~C   $ s u% 9   }qpps~~~~}|!r yD w w w | )c" { {     zzzzz- ~  - p/ }  ~ |y|* y x}~0|  } } ~{ :oi } j  $ { & w ~}~}}  01z u1 ~}}  $  )W )W~p  ~0*!50 $ }}- 9    -Q]%%?j$8| ~)~   0K \ e g q  w $.  5}~}}{r{}s} -(x~~   }|~4   Nx1!  U"^*) ~}}~~1$~  ~UHB}}    z )!q - 1 + D2) ' z)%uII xo\m~!~1 r s# i |x#]#0 u  ~}yw o  }~w v  v } ~~ $ 1~5  ~}~~5 ~w 6 }@  c|~~~ aQrkj I )~9a  +pri }wr   ix ~*~|~~w v w$ (]  ~1 z z    xx zzzzz15@) p/ O g ! b}! y op!9xx~    t } t ~, ~r*~& |{~~[ 5;#;**~p uM |  |  v x8/Q/ 4~! ~~ w~ " 3 O}~  )~(  0 p&} 9~~ E  w (}  1s~{!& %s*|yyy 7~  u5(zzzzz~ + ~S c5 \p5 eg5 Ys5 bj5 j (" l~urr   z{{}{S1 xt0 y x  ~y %~%u x    y)~   |}S y% ) }~~t "{6q    $  c  % x~}    |L(  w  1 w1 S1  1! %yy ~ ~ w ~~z+{{{{  }   y~~|| y x  } y)~-%*w trwDD-y  u  /~ ~x x B*q~~ }z~ K  } i} " |k /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclIOCmd.cˆlocale_attr.h춲 א t t u t   5   (   H0y   1  $ n 1 y7 (-)! )t   $,) -%       a 9  ,l  q  ,pp(|5$!-E0%~~    r  zY09! 2v p %e % !5)5%}%yyj $5 s{ = ~ , 1)!(  (!    z! t  ) )~  *   }  j(  ( y   #  (!( pp pp v   {  !  }  st{  v vyv 5 " M   v~ 4    5 c 9  ( ! (  u    v  ~ $5 '   ),@  0d8,u1 y  z ~ ~yy   v  #|  %    !   ~   $ p y |{   p n7I xx x u\&MyQ ;x y) 9 (u   ~ 1    v r  ?   5! v  !  t y u{ tL1  rx     K /usr/csbmb/src/TclTk/tcl8.0/generictclFileName.cݢ      r( n ` 7$ip x$\>f  P$1T g $i$||| z  1~2(2  ~    $~~M    7     !u~~% d$4|y   !u}~ ~% i /    9G  #u ($%    n"~  u T~ m r |! %l(1 9j -J${~ ~- F~  l t ( w} ^v( 5/ D($   t ,  w(!Z Qt~k v}r!o%'$  +z\   yw7"yz w (h= s$ -> )v y p| -x xx $  s7~~ | 1~  {) F - % v~"   P E1 p    {9  } ~ )~  y xv#  | { ,  q(~  ~ - ~  $na~ M1C! ~($!y   * ? ~    T3' !/  ~ |Z%~/|Q((*^ ~1 # ~~-   ~ ^- l} /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclCmdAH.cӝǟՙlocale_attr.h춲tclInt.hß .71-!  ~| w  ,," L}E~hh$/ m m mp* kiE)'09! !$! $ ,   (n r1 ( %!q(%~ !1-! x  k0-  %  p{, {" ( (~|$x  = }   W0%!x f> | |# {z (  >( " |$  $  z|.(   $! }$ }$ ~$ ~$~ ? Q} " o!~~  ~1 ~        -    -~|v    { ~|v {} ~   } }}1 & M gt% 9~49~}$w Z  t    !B;^$P ~ } }"/}5% 1% 1% 1% 1% 1% 1% 1% 1% ~% %z||{}q'  1  |  %  [   % k$ &  ~ wo#~-   FFFN $~}|{~~}||{~}||{|nn t~ s~mki-~ !$   !E    u ~}}a 3 I }    -{| "^ )W  oq )W? %~}   | ~y* $|A-,$~   v  8$ - <q~    $ } ~~ & { |  > ~~3      x ~0k /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclCmdMZ.cɟҢlocale_attr.h춲 i -!!  v }yh $<$81s w   ! ad{}{ 1$i1 g$@ F  >  I$ r   5 cj9 4(  xw w $ ^9 ! ,   6  . 4 (   }~6R.6R~ ee  }|~ ] ~  0S~~D(5 y   ~ |(>|5~ m5  (    z7 f|1\ l!|  -` 0w( , , ,    q |u q&~ > ~$b}q ~ }|      }}"$"}~$"}~$&~ J6*8$ z(Y %%` $v(oi", ~9~  ~ ~& T~~8(F~~G~Hy Me~=&*~~   (#xx  y j(-z4  ,T  - = z( U} ( (f () $ ( ( $ $= F (+ ( ( ~%0,| }~xt }~ |||  0 5x  x  00~ ~  9 ~ ~S}}9~~~1!    t t t   %(n~z {  ~s um  -J4\ r $ Hc1W%fg   .  t| - xxiyh}~ %6  3v{ ) ~5- jA~["=~ w  -( x~|U,u s 'X )4 | |1 ~1}} lk!~5  5%~z ~%~), 1|~~50 w w w %~ %  ~-~!)J u !( y|     b5u% /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclExecute.cßstdio.h춲olocale_attr.h춲tclInt.hßtclCompile.h箟errno.h춲 !Q -!0~|0  |z y~ ,    1   0  1  4  (,, h 5$U $d4| p (  $d%8.x   $8 ~AX = ,(1  6, )09 x=   P%Pz$! 9$)    $- -9 1   4($  -@9 @@1@ @4,$@1T-$A41$@ X 51$@  541$@@ 41$@ X41$@ 445$@@ X445$@@ 4445$@@@ 445$@@ 4 ,@,$@ 44 ,@@=$@@ @@44 ,@@1$@@ @A444 ,@@@5$@@@ @@A,$ 4=$@ 41$@ A445$@@ @AT4  $ 1,@T4  $ 1,@44 $1((-!-%(@@ $1((-!-%(@@IA 0   44,((,((dd$y )} y($((((y     0 44 !-(@@ !-(@@@@$- 0  44  !(( (@@  !(( (@@$Y@@  @@y Y @@$$ ! $ ,(( (4 ,(( (@  @0  4-(@ Y0$)%( 5 $, 4 $$,(( , -% !%    -91$ -9!1$1 ((>!(   ( ,,p  (    )(1$ Ah#[/ UU <1  1  )~X 2~   $,047  4  ~ z { 1!} ~ E  ~ ~ ~  ~A} ~ ~ ~  ~A} ~ ~ ~  ~A} ~ ~ ~y  - { s r5 ~}}}v*M%z  (% p{ h z| y ||W)U$ $ $ $ 5 }~z  } 0 zyiiih o-!~ 1!~n}r oohzge{h !h r$ |Aw! 4%c  zmmmml s% ~,!G%~-5ahl~| _z- &znnnn~ t-!~ 1!~yq " zllllk s% ~  !I)~1= --}  yr|!  #]"^":~yq{Y zllllk s% ~ #!F)~1=  ~y  y b- |! lllk~~cI! m9qqy u |% 3P~!e f ~%~ e:-~~& JeC )~( w %% A +}} { {   s4  v4  , o4     ~ ! ~  !  L -      | {{  t t%    z {L4 x[ /usr/csbmb/src/TclTk/tcl8.0/generictclNamesp.cǖtclInt.hß` ) }  ~1   x n ~  r(~ rcc x w w w }*|  0 R0~,{{ ~!        t    1! w   }  % 5}   % #Z      ~& { 7]     -    u    ~     ~ !$,   x  S40  )(}}   v ,  |-( ~~~W mz(   ~r}<   <:  }  s 7}}f       {       !w C ~ ,&$ Z  5            9 ~  %) z  S 6 !y&~ ~ z y  p  k |-~|   w y     8  ~ }    )   v% ~  ~x- } ~ } ~  ~}~ :}   }  ,     : : : ::~   z 4     : : : : :~ z -{ s     Qf t  u w  F+ `  ~ 8/} u  % !  Y 1  u(  ,t V , , , , , , , , , , , , !}}    t      t (    , t     z  { G  !$d  %= $@l}q  9(%%b; $  ~51) y    |~  $~ y  k    `0   -u(  }  Y  - r<   s k  $~  } [$ f ) }) 7 z  $~   }  x08     $~   } p4 s-   -v (  } U *~   ~C   vp$u  $51n, {  5  $ u   } i 2 $(& D   |  9o- $ $ @   ~ ~ u,z   ~  ~ T)"    e, ( - &   x  | ! u u&       |P    |~, |     w )!%x /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclGet.cDlocale_attr.h춲errno.h춲- v |zv )z45 f  } y#&h ^ ! + w |zw )z 45 m  } y&oe % ){{ z   k <5&)w w w y{{ ~~} z    } e  f  )( t$  0 $ 0 7F /usr/csbmb/src/TclTk/tcl8.0/genericregexp.c  {}|,}$f   |{{ t ,R %,o(y}@!} 0(,> v `!w z1}   ~*  x}!u  zxx~|  |~V0    e(8$4=|844 $<( zzz)}} ,$(( (1 5  ((ar{{~~!A ,{b !W~o& P   .  x~ }  )>FF}u }o  (x  4" $,~,(Q !z~{ ,|  q~ ~ ~ A~z~[~{}~   wyy{| R8 ~ %)$ }>yzx)  n   m$||$#| |)w}I /usr/csbmb/src/TclTk/tcl8.0/generictclNotify.c̯ŝ΀~~&/  }zx#   s# hv !d]~ )h "     r1  ri 5  w px z ||||O;b#} } { 1| }m 6 "o~ w  ~  ~   ~ !  A z  }  ~  ~}J0Lv} /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclCmdIL.cˆlocale_attr.h춲tclInt.hß }}n~1uzu % Uv5    \9 51){% |%)%~$  y( >k D ,,,,,,,,,,,,,,,,,,   (   $   ~  n9- ( |9! $(!{{ !  t  u(  ,g " !r.p$`br* v1} w ( $~   ( %  c   c b)z %  b 5  & $ . y - | "~~     v, y ~  y    d$ % 8  t   0(T 1 1 x  w   j 0 $ -,!1 ,%{#  u  x }   n( z (z  (x z~1 U   ,} $~  $  }, ~~ y ~     t v,  { ~    } $ e9 ( ~   % - $  },#yy !  u  u$  ,g h#  )`  } p .$\ } y  {  p z ~ {  9Bs}-|;J +.yy  -u( i }(  (% ! t (   t( u ,]  |  sax$   ~ $-( ( % |    ,i3  %w r-%%}} { W,$a5 v v,1~pEg!~})xxg0 rr{v ~}~4  y5 ~~T }r,(~  !^  ! eL  (!   .  y}777~  z# ) ~ y<~ { g 0t y{  (' l  1)~~}{x~1 ?~OO$o}{x)   x k x k ~ ~ ~ |%mq% 2 m  ~  y ~ (}h} "n r}}tD /usr/csbmb/src/TclTk/tcl8.0/unix/usr/include/usr/csbmb/src/TclTk/tcl8.0/generictclUnixFile.cŞjlocale_attr.h춲tclInt.hßerrno.h춲0? ) - =%}   $q q +z! ) }  =  D ([^  )r29  s _$ >}%$   w  w s|m( Z}v   $5 $9$~~  m i /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclPkg.c˦locale_attr.h춲' }(%9w$2  r r  w  uon}~~~{6A%qw ~- ~ W  !      $ q  Q   / U+ b q1 ~1 ($5 +11 5 $(5 ( ~  r  5s)n!~8 ~ {%o ! ~$ i 5`  %}11b(  V%4~ )!&  , 5$}w (0%um $ z1~  z|t  -n- v2)* f$  -~ }}j /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclLoad.cˆlocale_attr.h춲=$9z9~ t    5"5z(  4i $ * [ ~!*`"~ak%1 ! y$ 1~2~ -)~~n5~9 {}4 z~~ %} ~9=j  w  w4 42~~~~ x-}m7  |!) {%q- (}% ~1J /usr/csbmb/src/TclTk/tcl8.0/generictclPreserve.c8L  ) ~ |X r!~1zzn$ _ rs  ~ |'gg |k ~| /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclUtil.cßlocale_attr.h춲tclInt.hßO z lll4 pyxs< {|~ ~' uw  70,'Z/~~Q  |~E ) kC  |~E) k } {  ~!xt|~4 s s s  s s 5~1~   fpz u{b%&}c   } 3 "0P.R-S0z~g v % v v yWy\    D(dz!   1E~ | | | | | }~~p~q  80A|w~d 6 { {  { g 8 z_W"=  !||  f -   q  ~~~y]e    ux   4yK R CR | w ~  ~ _&a   |${{ t t %!o+  ,(}!n)- t t t! v  $ R   w| ~$c -  w!y!]?|!z /}}|y/  t )~| ||)," {  (L ~  o||({1$z~{}! |     ')~~ ~kf ~||  (j~, x{ z !$|~!t' )t} Wf$ ~  }~("}}~&   - ,)b  ~)%~~((rp~}Dp | 5j   ~~sn  9 |}} z $v wy -    | t,   8l /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclBinary.cßlocale_attr.h춲: ~ ~ ~}}z,} ,Y{,~92N2- !~ }2  p ~~1~ }  0~ }  } *}}G$|~1 z 9~ , (z 9~ (|  ~ ~   ! .G= Y%}~| ,   |z'}  6   } {|{   } {{{ % ~}}}})~W.  z z  9      y  y{  s1 { {  M~+6|6}~~ z 9~ :z 9~]6~ k| Z, 2, 5,{ |; H z  ! 6   s5 ~@ |;   3 6x) ~q ! | xQ0 s t w {$$$p) -$% $$] j|~!  - I /usr/csbmb/src/TclTk/tcl8.0/generictclInterp.cݢ@         ~ o   ({ u u u(0$   u   0  %/ q m~ /-q    n  ' v  { ~~}~ 9($    -   m c5 _  m  t ~v p =   }  {  x   ao .  | z x}  } &, S(   < v v    w=  ,Ag  A i  f / 6   } %  u u   x  $$~    ~ 2     ~      ~  ~    }}    }  u ~  w)  / }   6    z   H + 2  2 g     $  t      |~ !        - ^))o 8|0   t  ~ y( !    }~~~ "^ *(( @( ~$ V6  )% $ -  t  ! o) (  )% $ -  u  ! p) (  v s x ! z~~  g( .    x) 4  ! *, H u)  ~~$~  k ,  $%   {%  y ) r   s(    $     ~~  o)  ()    l ( ()  ))     f f  ((yy  )~9 (   ( q!%yy       $ )  P5 A % ~   % g ~ y    bAz!    y   t( & Z # W) _AAAAAAAAAAAAAAA ||  w m- 2 u       ~   (}~~~ *, R ~~$~ V 5  (% ( - w w (  (% ( - w w ( $  {>~  $!%~ } }  x)  y } } ! +, Q y% v)   ~~$ k 4 $! !     a  V  n03 fII  w  c 0 hp  |a  *V ~~ !~ ,  ~~ 5     &    J    F  N       >  F    F    0~         &    J    F  N       :  F    F    Q)~) ,  $ ! $-  ~ !~   C     j      ?         D.  - (v"    ~ ~   ~ $     yx$I   ||      y   z |  5   ] " ~  } n!&  ~ ~ y   ~ ~   ) 4      cs1 / ~ ~  s l ~ k=e /usr/csbmb/src/TclTk/tcl8.0/unix/usr/includetclUnixPipe.cerrno.h춲0!~  n%    y ,  k( ~   :zqy }  w ' Fuz, 5,jzz  ! yuy  } v   {W v %Y~  >}}} ~z v   w-~~r~( v  !$ ,(~ } ,   ~~   ~~  U 8zz  t  !|Z x X  '{| ~ ~|| ~ ~  u s r&~u =    !) !   (  ~j,[F /usr/csbmb/src/TclTk/tcl8.0/generictclLink.cc$ {~|~z| u"}}  ~5$  %=     w  x  9e %$ 'x$ X$9%9%9n  *}dtv~u!uH /usr/csbmb/src/TclTk/tcl8.0/generictclEvent.cß-p s m$,-,%,~ zs}}~! w  ~)     ~ c ~ B0U -~   !$% $ !r$) }}}~  z    3w  -)~~!- z|1 | 411| w  h /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclProc.cßstdio.h춲olocale_attr.h춲tclInt.hßtclCompile.h箟9p3 | | ( & % ~   y}%~ ~~! -  x  kg!5   ~   3%~  $%x u w w p} zji1&h | g0!<z zq||qzy   O, l {' }  z! z- s s s   "~zz& ~~~ ~W * l eh  }}}$~}{{%     T3  x! |]/ryg|x o-   z%(} s51 6%   [)n16}}~~~ ! y-}v '||~)))G /usr/csbmb/src/TclTk/tcl8.0/generictclAsync.cނ6QP}! {# }w u _8r {!J /usr/csbmb/src/TclTk/tcl8.0/generictclIndexObj.cˆHS`  $q:y &] ! {{}}i9}    %{{ s |   n$})hb /usr/csbmb/src/TclTk/tcl8.0/unix/usr/includetclMtherr.cɃerrno.h춲X|}}|}} /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclParse.cˆlocale_attr.h춲tclInt.hßX i }P   Yl :Gv }  9  ~wl $%*. | v v v ~"~~~& |  { |:O )W|-[_/)*\'&Y vx v||; w w z~uy {% o/|| !   - 0 V $\v x / ~yV|| w| a S"  = .h  r *  j s  %x~1}u, | &   <l|nw t   %ihh+U}" e  7 ~$@~} } ~ ~}~} ||||} ~ !8%!$a /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includepanic.cstdio.h춲on9U z~5v /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclFCmd.ctclInt.hßerrno.h춲o7$ $ zzz!  u xt T yw -omo*y w  wz xm  r  )o\)=l!j0{{{~~6 [P$[  ~ MA i+9 %!%      ~     ryb~}}{}}[32N2E  }2N  K )pq 1A _-7$ w z z{& v~- t.|| u 1 f-x :( q  | {  S " R - p )~    } 5:x  ~s ve /usr/csbmb/src/TclTk/tcl8.0/unix/usr/includetclUnixFCmd.cݜerrno.h춲  %%[%[%p#  | zz~r Q(~! _~! qg.y   ~ v sss(t ~! ~!# {$ 9%|}~%|  ,k8 |  x{5%    %~   hh^!*(e?$ ~g$$$, x ~uz, $ t (}~~!||% ||% ||)!~||!~  )l(||!~ n' v  !d /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclPipe.cŝerrno.h춲{  !i1fY  9)  L%~~ X ~  r|}   qA   z m  m    f }u }p!   D )  O$('(Z j sy     ~|~ } ~r  py   d%}o ~n  6~ n ~3M  | |H"226~ t u~#]~~ |E~|GE~A    }~~}E. /Q ~    K9G;E9~ x  wI z! ~~} =s ~~ ~~|  ~ f * c ~ *y ~}y s  {}{}~_   q%% h /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclPosixStr.cerrno.h춲p' |          |          ^ /usr/csbmb/src/TclTk/tcl8.0/generictclStringObj.cˆtclInt.hߊ|4dx ~  " !!o -  ~%j} !!"  f} t}- zzz ! t  |},{ ks (yy g /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclCkalloc.cstdio.h춲o0     |     |    G /usr/csbmb/src/TclTk/tcl8.0/generictclHash.c点~~y tw z{} w! )~r$xx, vr5}}   ~~y!   m  u w~2 z{z{ $%(}1 $,}{!{   u w***|#{{ z %** ~|~ ~ %X}&|| z v  $  e  z 5~~~ ~~ ~~ ~~ ' v | |~&l ~~3 z 5~~~~~ ~~ ~~ z p { {~& ) z 9~~~~~~~~ ,~R ~~#'  wy ~ ~ %~ ~ ~~~~I  a*n w%~~~~ ~~ y~| ~Z ~H /usr/csbmb/src/TclTk/tcl8.0/unixtclUnixEvent.c#  {}"} )~q xpc /usr/csbmb/src/TclTk/tcl8.0/unix/usr/includetclUnixTime.cі,time.hظ&$     u9|H /usr/csbmb/src/TclTk/tcl8.0/generictclIOSock.cʝp*A}y |%{{*w*O} /usr/csbmb/src/TclTk/tcl8.0/generic/usr/csbmb/src/TclTk/tcl8.0/unixtclEnv.cßtclUnixPort.hÈOo1 xv w    n}{  $oor} 4   ,0&,yyy~{~u%pzx q&&  $1"U | ~.~&  %b ~r5 u . |JJFJqu9%~ p*& 5 .|'.|.| G /usr/csbmb/src/TclTk/tcl8.0/unixtclUnixSock.cÈ? y  x y % p~~ E[ /usr/csbmb/src/TclTk/tcl8.0/generictclHistory.ctclInt.hß1 )~ $}~}~ c $  v ~}~~yv j /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclCompExpr.cͥlocale_attr.h춲tclInt.hßtclCompile.h箟errno.h춲  } }  i}H{ u~ s w w{r~I$  ~9 ~1 v  w    }~}|  |   u zC  qq~  || ) $}}   _v!!%%)!%%)m  qq~  || -) $}}   _v!!%%)!%%)m    {j~$}}zz,  {j~$}}zz,  {j~$}}zz,  { y} d~}}s{ 1  { y}'X~{} Y$$$ w0  { y} d~}}s{ 1  { y} d~}}s{ 1  { y} _~}} l|~!1z , v v*  W~ ~i((( w5 v q{q  X0$&~~~)~%% )K,1v ll-~~   1 ~~g  R <E X(96 QI meu w $fu! !%~~|`$\$\~ "}5 v9 ~  ~~~$41}\$I4-y 0~! {~}}1 yy~{~  ~ q  Gm~~ zz%-|E~[   G /usr/csbmb/src/TclTk/tcl8.0/generictclClock.cˆ;8@3 |o {  }}|~z,y((% {}Wa-%- y( { )*,{t, Sby( -w H/1 u u # +~~~~~~~~~~~~}1 Y yj /usr/csbmb/src/TclTk/tcl8.0/generic/usr/includetclDate.clocale_attr.h춲@@ r q ~  w    xx~  { { {   $ .  "    |  |  |  *  *    * jx }o | |    :  *    *   )a ( {<~~   w $}||  -*  g8 v     (    z } % j   0          W 1 c ! ~    }  $ V !  5 p "x 8  v  "     '~ ~ _ !  zb*   *" | k xy~} ~ v t ~ A   Q  % f   u  f}hi{zz()} ~}%zs  & 0~  '~%   "qp"n u w "~ z }~~z$2( v ~   ~~~~ ~ N ~ : |               |~~  | }}||    | ||{{    ~  ~  ~      ~  ~  }  ~  }  ~}   }  ~ 0  0  $        $  $     |   |~ 2 crtninit.s 3  40j=.P l  o0+PA$f|BpH!`Y#q'P@+? .,$13ƐY: ` D<[*>0@ 8@u: LCE,GqlISwpM;pP<SMPzZ& ]V0_6 3LbipjfY (h70j,n0oL1r;1Fxxl|P zpBX eoUA8a`$g-X6` h(/ K="8p_;y`` `ch$`"W"@ ɳ.P&͖U (p_@<ee`8t 8ާ`D۰ 0*t  ) <` =Px[ NX` V02 f7  L   0" 0Q   !$ W 13 @# ^ c }! p* '25 $4 - 9j @iBH `E6 FN ߤY א+^p ,b .:f iHDj q`Dz 4|΀ `CH0  ' =pL O;`@g0$-p )9pQPS`NX\@Xĸn o )Ѧp$Šץ0ڽެ4Tp( @DJ4[8@e@@` h5 P j TCreateTopLevelWindowGGetScreenNameWindow UnlinkWindowOpenIMDeleteWindowsExitProcFInitialize EvalArgv ParsePriorityAddFromStringReadOptionFileBNewArray_ExtendArraySetupStacksExtendStacksOptionInitClearOptionTreeGetDefaultOptionsPUpdateDependantFontsTheWorldHasChangedRecomputeWidgetsConfigAttributesObj8GetAttributeInfoObjaParseFontNameObjFieldSpecifiedNewChunkQImgPhotoCreateuImgPhotoCmdParseSubcommandOptionsImgPhotoConfigureMasterImgPhotoConfigureInstanceImgPhotoGet?ImgPhotoDisplaydImgPhotoFreeImgPhotoDeleteImgPhotoCmdDeletedProcImgPhotoSetSizeImgPhotoInstanceSetSize&IsValidPaletteJCountBitshGetColorTableFreeColorTableAllocateColorsDisposeColorTableReclaimColorsDisposeInstance?MatchFileFormatdMatchStringFormatDitherDitherInstanceBDrawCharsAllocFont2GetControlCharSubstY!`JFFindConfigSpeciDoConfigFormatConfigInfoFormatConfigValue9#mBorderInitShiftLine Intersect'(ButtonCreateButtonWidgetCmdDestroyButtonConfigureButtongButtonEventProcButtonCmdDeletedProcButtonVarProcButtonTextVarProc#ButtonImageProcHButtonSelectImageProc+?_DeleteImageZ1p(AllocXIdWindowIdCleanupWindowIdCleanup2CheckRestrictProc3MatchPatternsExpandPercents8ChangeScreen|InitVirtualEventTableDeleteVirtualEventTableCreateVirtualEventDeleteVirtualEvent#GetVirtualEventHGetAllVirtualEventsqHandleEventGenerateGetVirtualEventUidFindSequenceParseEventDescriptionGetField+GetPatternStringQGetKeySymoInitKeymapInfoFreeTclBinding<[.ColorInit:>yFindClosestColorDeleteStressedCmap@usBitmapInitC RegOpen)RegFindNameJRegDeleteNamemRegAddNameRegCloseValidateNameServerSecureYSendInitwSendEventProcAppendPropCarefullyAppendErrorProcDeleteProcSendRestrictProc+UpdateCommWindowGaAtomInit8ISWindowEventProcDelayedMotionProcM;xReleaseButtonGrabMovePointer2YEatGrabEvents|GrabRestrictProcQueueGrabWindowChangeGrabWinEventProcFindCommonAncestorcP7DisplayExitHandlerDisplaySetupProcDisplayCheckProcDisplayFileProcSMsConfigureEventAReparentEventdComputeReparentGeometryWrapperEventProcTopLevelReqProcUpdateGeometryInfoUpdateSizeHints(WaitForConfigureNotifyTWaitForEventvWaitRestrictProcWaitForMapNotifyUpdateHintsParseGeometrySUpdateVRootGeometryUpdateWmProtocolsGetMaxSize!CreateWrapperMenubarDestroyProcMenubarReqProcQZMaintainMasterProcMaintainSlaveProc;MaintainCheckProc]VTGCInit]_yWaitVariableProcWaitVisibilityProcWaitWindowProcwGetToplevel-b;GridReqProc[GridLostSlaveProcAdjustOffsetsAdjustForStickyArrangeGridResolveConstraintsGetGrid.SetGridSizeNCheckSlotDataqInitMasterDataUnlinkDestroyGridGridStructureProcConfigureSlavesStickyToString=StringToStickyQh7SeSetFocusGetFocusGenerateFocusEventsFocusMapProcjyEmbedErrorProcEmbeddedEventProcContainerEventProcEmbedStructureProcEmbedFocusProc6EmbedGeometryRequest`EmbedSendConfigure"EmbedWindowDeletedoL:PackReqProcZPackLostSlaveProcArrangePackingXExpansionYExpansionGetPackerPackAfter Unlink;DestroyPacker]PackStructureProcConfigureSlavesr;{;MenuWidgetCmdDestroyMenuInstanceUnhookCascadeEntryDestroyMenuEntryMenuWorldChanged@ConfigureMenucConfigureMenuEntryConfigureMenuCloneEntriesMenuCmdDeletedProcMenuNewEntry(MenuAddOrInsertMMenuVarProcCloneMenuMenuDoYPositionGetIndexFromCoords&RecursivelyDeleteMenuDestroyMenuHashTableqDeleteMenuCloneEntriesKx9ComputeMenuGeometryDisplayMenuAdjustMenuCoordsR|GetMenuIndicatorGeometryAGetMenuAccelGeometrykDrawMenuEntryBackgroundDrawMenuEntryAcceleratorDrawMenuEntryIndicatorDrawMenuSeparatorDrawMenuEntryLabelADrawMenuUnderlineGetMenuSeparatorGeometryGetTearoffEntryGeometryDrawTearoffEntryhSetHelpMenuGetMenuLabelGeometryz:TextWidgetCmd]DestroyText~ConfigureTextTextWorldChangedTextEventProcTextCmdDeletedProcInsertChars2DeleteCharsSTextFetchSelectionTextBlinkProcTextSearchCmdTextDumpCmd0DumpLineNDumpSegment OoGetStyleFreeStyleLayoutDLineUpdateDisplayInfoFreeDLinesDisplayDLine5DisplayLineBackground`DisplayTextTextInvalidateRegionMeasureUpScrollByLinesmGetXViewGetYViewFindDLineeCharDisplayProcCharUndisplayProcCharMeasureProcCharBboxProcAdjustForTabSizeOfTab7NextTabStopXMeasureCharsxotkDestroyNodeDeleteSummariesSplitSegCleanupLineMChangeNodeToggleCountxFindTagStartFindTagEndIncCountCheckNodeConsistencyRebalance0RecomputeNodeCounts~CharSplitProcCharCleanupProcCharDeleteProcCharCheckProc ToggleDeleteProc1ToggleCleanupProcXToggleLineChangeProcToggleCheckProc%MarkDeleteProcMarkCleanupProcMarkLayoutProcWInsertUndisplayProcMarkCheckProcMarkFindNextMarkFindPrev%Y0ScrollRestrictProc(aForwBackvStartEnd:GEmbWinConfigurelAlignParseProcAlignPrintProcEmbWinStructureProcEmbWinRequestProcEmbWinLostSlaveProc,EmbWinDeleteProcREmbWinCleanupProcxEmbWinLayoutProcEmbWinCheckProcEmbWinDisplayProcEmbWinUndisplayProcEmbWinBboxProc5EmbWinDelayedUnmapLHEmbImageConfigureoAlignParseProcAlignPrintProcEmbImageDeleteProcEmbImageCleanupProcEmbImageLayoutProc.EmbImageCheckProcTEmbImageDisplayProc}EmbImageBboxProcEmbImageProcMghFindTagSortTagsTagSortProcChangeTagPriorityV6FileMatchPPM?FileReadPPM_FileWritePPMReadPPMFileHeaderkX$ClipboardHandlerIClipboardAppHandlerqClipboardWindowHandlerClipboardLostSelDK%ySelGetProcHandleTclCommandLostSelectionpSelTimeoutProcConvertSelectionSelRcvIncrProcSelectionSizeIncrTimeoutProc3SelCvtToXRSelCvtFromX;%CursorInit@CanvasWidgetCmdeDestroyCanvasConfigureCanvasCanvasWorldChangedDisplayCanvasCanvasEventProcCanvasCmdDeletedProcInitCanvasStartTagSearchNextItem#DoItem?FindItems^FindArea|RelinkItemsCanvasBindProcPickCurrentItemCanvasFindClosest CanvasDoEvent0CanvasBlinkProcTCanvasFocusProcxCanvasSelectToCanvasFetchSelectionCanvasLostSelectionGridAlign PrintScrollFractions5CanvasUpdateScrollbarsaCanvasSetOriginP"CreateRectOvalERectOvalCoordshConfigureRectOvalDeleteRectOvalComputeRectOvalBboxDisplayRectOvalRectToPoint OvalToPoint@RectToArea_OvalToAreaScaleRectOvalTranslateRectOvalRectOvalToPostscriptW\"CreateWinItemDWinItemCoordsfConfigureWinItemDeleteWinItemComputeWindowBboxDisplayWinItemWinItemToPointWinItemToArea>ScaleWinItem`TranslateWinItemWinItemStructureProcWinItemRequestProcWinItemLostSlaveProcɳ"CreateLineALineCoordsaConfigureLineDeleteLineComputeLineBboxDisplayLineLineToPoint LineToArea+ScaleLineJTranslateLinelParseArrowShapePrintArrowShapeConfigureArrowsLineToPostscriptArrowheadPostscript͖ CreateImage@ImageCoords`ConfigureImageDeleteImageComputeImageBboxDisplayImageImageToPoint ImageToArea-ScaleImageMTranslateImagepImageChangedProc"CreateTextATextCoordsaConfigureTextDeleteTextComputeTextBboxDisplayCanvTextTextInsert TextDeleteChars2TextToPointRTextToAreaqScaleTextTranslateTextGetTextIndexSetTextCursorGetSelTextTextToPostscript&e-GetPostscriptPoints"CreateBitmapCBitmapCoordsdConfigureBitmapDeleteBitmapComputeBitmapBboxDisplayBitmapBitmapToPointBitmapToArea8ScaleBitmapYTranslateBitmap}BitmapToPostscriptFrameWidgetCmdDestroyFrameConfigureFrameDisplayFrame FrameEventProc1FrameCmdDeletedProcYMapFrameާ=FindSlave\UnlinkSlave|FindMasterConfigureSlaveRecomputePlacementMasterStructureProcSlaveStructureProc7PlaceRequestProc\PlaceLostSlaveProcuArcCoords]ConfigureArcDeleteArcComputeArcBboxDisplayArcArcToPointArcToArea!ScaleArc?TranslateArc`ComputeArcOutlineHorizLineToArcVertLineToArcAngleInRangeArcToPostscriptE=ScaleWidgetCmdaDestroyScaleConfigureScaleScaleWorldChangedComputeFormatComputeScaleGeometryScaleEventProc=ScaleCmdDeletedProcScaleVarProcvUDisplayVerticalScale~DisplayVerticalValueDisplayHorizontalScaleDisplayHorizontalValuegLMenuButtonWidgetCmduDestroyMenuButtonConfigureMenuButtonMenuButtonEventProcMenuButtonCmdDeletedProcIMenuButtonTextVarProctMenuButtonImageProc`CMessageWidgetCmdiDestroyMessageConfigureMessageMessageWorldChangedComputeMessageGeometryDisplayMessage+MessageEventProcQMessageCmdDeletedProc{MessageTextVarProc2DListboxWidgetCmdjDestroyListboxConfigureListboxListboxWorldChangedDisplayListboxListboxComputeGeometry-InsertElsLDeleteElskListboxEventProcListboxCmdDeletedProcGetListboxIndexChangeListboxViewChangeListboxOffset.ListboxScanToQNearestListboxElement{ListboxSelectListboxFetchSelectionListboxLostSelectionListboxRedrawRangeListboxUpdateVScrollbarFListboxUpdateHScrollbarrErrorProc."CreatePolygonDPolygonCoordsfConfigurePolygonDeletePolygonComputePolygonBboxDisplayPolygonPolygonToPointCPolygonToAreafScalePolygonTranslatePolygonPolygonToPostscript ImgBmapCreateBImgBmapConfigureMastermImgBmapConfigureInstanceNextBitmapWordImgBmapCmdImgBmapGet%ImgBmapDisplayIImgBmapFreeiImgBmapDeleteImgBmapCmdDeletedProcGetByteX\IScrollbarWidgetCmdpConfigureScrollbarScrollbarCmdDeletedProc'Q7StdinProcUPrompt TFileMatchGIF?FileReadGIF_StringMatchGIFStringReadGIFReadGIFHeaderReadColorMapDoExtension GetDataBlock-ReadImageLLWZReadBytemGetCodemInitMreadMgetcchar64Fread W>EntryWidgetCmdbDestroyEntryConfigureEntryEntryWorldChangedDisplayEntryEntryComputeGeometryInsertChars;DeleteChars\EntryValueChangedEntrySetValueEntryEventProcEntryCmdDeletedProcGetEntryIndexEntryScanTo2EntrySelectToTEntryFetchSelection}EntryLostSelectionEventuallyRedrawEntryVisibleRangeEntryUpdateScrollbarEntryBlinkProc=EntryFocusProc`EntryTextVarProcg3+4FreeListInternalRep]DupListInternalRepSetListFromAnyUpdateStringOfList.^ @SetBlockModeCloseChannelsOnExitGetChannelTableDeleteChannelTableCheckForStdChannelsBeingClosedRecycleBufferDiscardOutputQueuedCheckForDeadChannelFlushChannel7CloseChannelDoWriteDiscardInputQueuedGetInputCopyAndTranslateBufferGScanBufferForEOLmScanInputForEOLGetEOLDoReadCleanupChannelHandlers #UpdateInterest FChannelTimerProc DeleteScriptRecord CreateScriptRecord ChannelEventScriptInvoker CopyData CopyEventProc (StopCopy! 7InitTypeTableFinalizeTypeTableFinalizeFreeObjListDupBooleanInternalRepSetBooleanFromAnyUpdateStringOfBooleanDupDoubleInternalRepSetDoubleFromAnyUpdateStringOfDoubleDupIntInternalRepSetIntFromAnyUpdateStringOfInt*`cfgetospeedcfsetospeedcfsetispeedtcgetattr-tcsetattrJFileBlockModeProcpFileInputProcFileOutputProcFileCloseProcFileSeekProcFileWatchProcFileGetHandleProcCTtySetOptionProciTtyGetOptionProcTtyInitTtyGetAttributesTtySetAttributesTtyParseModenTcpBlockModeProcWaitForConnectTcpInputProcTcpOutputProcTcpCloseProcTcpGetOptionProcCTcpWatchProcdTcpGetHandleProcCreateSocketCreateSocketAddressSTcpAccept4InitTimerTimerExitProcYTimerSetupProc|TimerCheckProcTimerHandlerEventProcbGetAfterEventAfterProcFreeAfterPtrAfterCleanupProc9jMakeUpvarCallTracesNewVar ParseSearchId,DeleteSearchesDeleteArrayCleanupVarVarErrMsgPBHInitNotifierNotifierExitHandlersFileHandlerEventProc<E6 DeleteInterpProcYHiddenCmdsDeleteProcN @FreeByteCodeInternalRepDupByteCodeInternalRepSetByteCodeFromAnyUpdateStringOfByteCodeGetCmdLocEncodingSizeEncodeCmdLocMapCompileWord$CompileMultipartWorduCompileBracesDupForeachInfoFreeForeachInfoCompileExprWordCompileCmdWordInlineLookupCompiledLocalAdvanceToNextWordExpandObjectArrayEnterCmdStartDataEnterCmdExtentData-InitArgInfoMCollectArgInfoqFreeArgInfoCreateExceptionRangeYxTcpAcceptCallbacksDeleteProcRegisterTcpServerInterpCleanupUnregisterTcpServerInterpCleanupProcAcceptCallbackProc?TcpServerCloseProc^pFileNameCleanupExtractWinRootWSplitUnixPathzSplitWinPathSplitMacPath3DoTildeSubstwSkipToChar4bGVStoreStatDatayGetTypeFromModefTraceVarProcj!InitByteCodeExecutioneGrowEvaluationStackPrintByteCodeInfoIllegalExprOperandType CallTraceProcedure2GetSrcInfoForPcExprUnaryFuncExprBinaryFuncExprAbsFuncExprDoubleFuncExprIntFunc3ExprRandFuncUExprRoundFuncxExprSrandFuncExprCallMathFuncFreeCmdNameInternalRep@DupCmdNameInternalRepjSetCmdNameFromAnyUpdateStringOfCmdNameqNamespaceFreeInvokeImportedCmdDeleteImportedCmdGetNamespaceFromObjhNamespaceChildrenCmdNamespaceCodeCmdNamespaceCurrentCmdNamespaceDeleteCmd NamespaceEvalCmd/NamespaceExportCmdWNamespaceForgetCmdNamespaceImportCmdNamespaceInscopeCmdNamespaceOriginCmdNamespaceParentCmd NamespaceQualifiersCmdLNamespaceTailCmdrNamespaceWhichCmdFreeNsNameInternalRepDupNsNameInternalRepSetNsNameFromAnyUpdateStringOfNsName|regregbranchregpiece5regatomRregnodenregcreginsertregtailregoptailregtryregmatch:regrepeatYregnext7InitNotifierNotifierExitHandler9)InfoArgsCmdJInfoBodyCmdkInfoCmdCountCmdInfoCommandsCmdInfoCompleteCmdInfoDefaultCmdInfoExistsCmdInfoGlobalsCmdCInfoHostnameCmdgInfoLevelCmdInfoLibraryCmdInfoLoadedCmdInfoLocalsCmdInfoNameOfExecutableCmdInfoPatchLevelCmdEInfoProcsCmdgInfoScriptCmdInfoSharedlibCmdInfoTclVersionCmdInfoVarsCmdUMergeSorttMergeListsSortCompareDictionaryCompare8?FreeCurrentDirFreeExecutableNameF ,FindPackageuCheckVersionComparePkgVersions35LoadCleanupProcYLoadExitProc#PreserveExitProc$OSetupAppendBuffer@bGetFormatSpec FormatNumber/ScanNumberi MarkTrusted1GetInterpPCreateSlaveqCreateInterpObjectDeleteOneInterpObjectDeleteInterpObjectAliasCreationHelperInterpAliasesHelper>InterpAliasHelpereInterpExistsHelperInterpEvalHelperInterpExposeHelperInterpHideHelperInterpHiddenHelper)InterpInvokeHiddenHelperWInterpMarkTrustedHelperInterpIsSafeHelperInterpSlavesHelperInterpShareHelperInterpTargetHelper#InterpTransferHelperMDescribeAliaspDeleteAliasGetTargetSlaveAliasHelper%SlaveAliasesHelperMSlaveEvalHelperrSlaveExposeHelperSlaveHideHelperSlaveHiddenHelperSlaveIsSafeHelper SlaveInvokeHiddenHelper9SlaveMarkTrustedHelpereSlaveObjectCmdSlaveObjectDeleteProcAliasCmdAliasCmdDeleteProcMasterRecordDeleteProc%SlaveRecordDeleteProcpRestoreSignalsSetupStdFile)PipeBlockModeProcPPipeCloseProcsPipeInputProcPipeOutputProcPipeWatchProcPipeGetHandleProc0r.LinkTraceProcPStringValueHHandleBgErrorsBgErrorDeleteProcVwaitVarProc@)oInterpProcProcDeleteProcCleanupProcRDupIndexInternalRepSetIndexFromAnyYl>o @468:C6BBB8CAp AA@CFZ @C@$5?p B@AD F@V @B@45@0 B`ADF@ Y @B`A@ (5A B@AD AD@\ @C@,5B \ AA@ABBCBG~$5CL A0ABA@ B U@ @A,7PE AABAB@D IF ,7PG A`AA@AB DBC C,7PIp APA A@AACCBC (7PLP ApAABB@C E $7PMp B AF@M @C@ 7PNp AA A@BH7PPd A0BC@ P7PPt AA@AAABFH n BH AAlG  X7PTp AAABBDB@CFEA$B rCA$A J$ 87P^PT AA@BBC DDAAD BB,7Pa A`AE@j @B`@7Pb EA J@7Pnp ApDF@$7Po B0B D O@P @E 7Po A0A@ BEC 7Pp|  7Pq0 AB A@B E@ @A$:xq A@ABC A C@ :xrT ApADA C@0:xt0 A`AAA@ AAAADF @ @A4;wp( A`AAEBFf@ J @B@ A,;x D`BXB`L@ B @A@ ;yx B0AD A@ ;zd G@(;zpl ApAA@D B CA ; A`A CAC@ ;x ; $ ,;P A@AB B DV@A @A@ ;P B@AB B E@ ; B0C F@X @;h A0C A C@ ;p B ABC@C@ @A,= p ApA@CCAH JS H= l AA@BBCW OJ F }E FW \ = `@ A@A D AL@$=  B0A R@M @H@(= ` A`C A BBCC@= 0d F`CG P@=  AAA C"BBC$C&HA@UD @AA@B @I@HJIQAAABJBABBAiBABBABHHGG$= 0H ACAA`@g @,=  A0A D AZ@D @B@D @= @ B@C@ G=  = pp A0A BA@ (= T A0A@ BB L @= @ = 0`  = | D BP@F @@ @A@l BAM@@H B AF@@ B0A DA@@p` A0C A C@4@ C@ADE@ A BBU @DD@ CADBB ABA A@Ad @D0@ BABD@E FAB XL@ BpABD@N GF A]LCT B FI,@ BADB@DCA A @ @AAP| B0AD A@ XA APA EB L@| @L@E @B@J @H@E @B@g @A@B @C@D @E@A` A0A@ A BA  A@ACA HJ@ D @CCB@ D @E@ C @F@ F @F@ D @D@ C @D@ C @R@ C @D@ C @FA@ N @D@ C @D@ C @D@ P @B@ R @A0 D0CN@0A50 AA A@ CCAH"^Q"$Al CPCNqCL@$A< C0C N nC C@HA A@AA D AT@K @M@D @H@b @b@J @H@D @(APL AAABC@D J A ApAA@ C F\A AAAFFDCg@ M @L@ F @G@ D @O@ G @K@ F @M@ G @H@ A A0A D Z@tA  A`AAB\GBM C\@ D @^@ a @BABCABA B[@ Y @e@ M @H@ AL A@AA A E@(A4 AA@AA A BBAP A`A G@A  A BC@CA C AH D H@LA AGB ZJ@^ @T@ @m@ @F@H @AB@Q @G@(Ah ApA@B AA ADB4A  AAAA A DE^@E @A@ A T A`A C L@l @0A ApAGK@C @NBp4A APACBB ^@ G @A@ C @M@ (A B`BH@ @C@ A E At APE HAC@ |A`, AAAAA"DD CKC@CC @ACO@D @O@- @F@C @B@K @CC@D @A@,A( APC A E\@T @D@,A A@C AEf@z @DC@(A ApBDAO@ N @F@ Ap $A P CpB Z@D @K@$A!0 A`AC A@D VA"$ HA# A@A DA T@R @[@C @E@k @J@N @A@C @C@A% D0A V@A&0 A0D A S@A&$ @ @A$J& APADAP@ E @ J' H0C Q@ D @J(\ C BK@TJ(p AAA$ABB"DC G@AKABBC @E@EDJ+` BPA D AI@HBkRTECF @E@,J- B0D A KL@E @A@J.`L D BI@(J.X B@AAA B BB@@ @AhK0 BABCAC@oHM uJ @C@q MF (K40 BPA DAD@^ @C@K5H EB@@ @A$L|6 | DPCAE@ Q @A@ ,L|78 APBCCCJ@ c @F@ hL|9 ADAJGAA A E@] @A@BO @D@E @A@C D @\@C @B@@L|< ApACCCF@B Ad @F@L } w8L|? APADAC C@B ATK @A@HL|@` AACB BE@AABB AB` @,L|A` A`CCBBE@S @D@,L|C A`CCBBE@S @D@ L|DL ApA@ C CA L|G| ApA@ BCAL|Kp L|K8 L|K HL|K A`CCAF@lA A A @A@Al @AA A L|M AA@CCA$L|g, A`FG@ h @C@ L|hP B0A I@ L|i0< @ @AOipD BCCBBM@(EUQ @F@(I @B@( @C@(OT D BJ@O x D0C A C@Oh BI,D"AI @A&A.F(N*B$ @Q$D.A*N@E&C( @GF A@A$A&A(A*B. @P.(*$&@OD DO`L B`ABGK@A @D@L  @E @H @E @O0 AABE@AN)AA@B AA" @D" @E @AE@I @Ei" @(O< B@A E@D x @E@$O A0B B P@ @A@,O ApAABCT@ ^ @G@ O B0F@,O A0A B FA@S @X@(O A0C A H@D @C@O @`O0, B0D A KD@H @EJN@F @DC@d @DE@F @B@CB @D@O`x AEABCD A@A*AAA@F @A@ *@B @AA A@AA@A*O A c@OӀ| @ @A`Td  BD"A AAA$CCD&CX@ @BW@y @D@I @j@JS @C@$Td@ BABB CC@0TdP( BPA BCA@ GB^FA8Td B0A DA@ AX @C0 @ @ @APU0 A`ECAL@ @B@ A hQ @C@ M i @F @ ^F SF 8U CPCD C S@Y @G@D @D@J @e@hU C@A DA X@F @K@I @I@ @B@P @H@ @H@K @B@ F@F @U, (U  APB C A[@I @F@<U@ A@AB D AZ@E @M@B @A@F @U@Ut AJ@ U` D0A F@Z @@ @A,W\ AA@ E r @C @ $W\ BPB B C@DP W\ B0AD A@ DW\ W\ H D AI@ W\p A@ABHB@ $W\0 E@B S@T @B@ W\ E@C N@O @ W\ APA BBB@W\P AAR@ W\ | B AO@G @(W\ B0A B\@ @C@K @(W\p DCN@ @H@P @@W\0 CAEA@CD A B` @B@D$W\0 A X@B @A@E @ W\l B AM@G @@ @AY0 B`E J@@ @A`Z, ACCBBI@E FQ  @F@I G @B @Z, T D BJ@Z, x D0C A C@Z,P AA AO@A @AAAD@LH DJ BL M @D  @uK Z,P Z, (Z, B@A E@D p @E@4Z, AA$AA"A*AA(A@ A&BA,Z, A0A B FA@S @X@Z, 4 B AD@`Z, X B0D A KD@H @EMO@E @DC@i @CI@F @B@CB @D@\Z,#P ACR.AA@0A2A8A4A6C: @B246<:.>8@0@ @AX]1 AA@ACBBI AA&BDCJwdQ& 4]6 AA@ECAG E FP (]E BBBC M@W @F@H]G0H APA ABA@L ACsM FDB h,]I B0C B P@B @G@BJ]J B Ad@T]K0 A@A BCA N@D @D@C @G@D @[@X @C@E @B@D @B@(]M BPADA@ACB A 4]M AA$A A@"BABBDCC<]P BpFC T@ J @G@ E @F@ D @D@ j @F@ ,]U AAFFAN@(x @A@(]XP$ ApBAEBX@Q @Cp@F @C@V @Bp@Y @C@F @C@F @C@F @C@F @E@Q @Cp@O @Bp@G @][H C BH@4][ A`ABCB@CC wIBG@]_d ABAI@K @I*C@XC @E@I @A*A@$]dl CPCAH@T @C@0]e A0D AT@B @B@C @D@L @ ]f`h C0A G@K @<]f8 AABD@CB H F @B@f ]l APA ABB@]l ApE A@ O,]n A@BAB@ CAA aH]oP| AAAA BBCB@CiAA ^BAA <]q AAABBCB@M A GN pF ]tH B0AD A@ ]t B@AD B@]u B@AD A@ ]v0d B0AB CA@ ]vl A0C A O@@]w| AA AA&B(A$E AA@AAJ @]xH BAI@@ @Acx$ cy, Hcy@ A0C A F@C @D@C @D@C @D@C @D@C @D@C @8cz A0C A G@C @E@C @E@C @E@C @0cz BAE@AEH G] fc} AADAN@ E @g@ EC { @D@ C @F@ C @F@ C @F@ C @H @ Q @D@ B F @F@ E @D@ cPT C CJ@ cd B0B B H@G @c A0D A n@$c A0D A G@\ @D@ch CPCO@dc` AACDCKD@BDH AB XO b\ @F@D @L@Dc P B0D A U@E @C@I @I@D @D@D @B@H @C@cp\ DPAM@cl B`AE A@,c@\ ApAD AI@ Q @L@ ^ @ c C@Q@L @G@@ @AgpP< A A@Bgp gp  gpt E AH@K @gp0 gp@P B BB@gp gp  gp| E@CJ@E @(gp@ GJ@T @F@F @L@$gpPt AU@V @e@J @$gp CCk@Z @S@gpp BPU@Hgp AAAAAFO@W @W@E @M@Y @V@f @F@gp AN@^ @gp4 B0A D@ gp gpX B@BL@`gpP BB(E&H BAAAAD@K C; @S  @,gpp BCAJDJ@A_ @gp  gp A@A EA@{ @dgp AC*A2A0A(A.A&A,C$WAB@B\ @DBAT@ @D@g @E@0gp APCBG@D @L@F @F@G @<gpP AA&DA L"AABC$C@G K A gpP gp` @ @A8kp ApCCAJ@Q  @A@\ @F@0k0 AA@ GBCACG AR (k  B`A DA@L AMKkð| AD@Dk0@ B@AD B@ 4kp BPD AX@e @J@I @C@_ @E@ kˀh A0AD H@H @4k\ ApAA@ABAL AtH B(kPD AG@ o @C@ xkР AAA E BQ@AXAAAD N @KB@F EEACCCkӰ APC A L@ kԀ BPC B I@p @kՐ AGBAF@@AA$A(ABD:b @AAA:A@@AA$A(^ @B:$(@@k  BA"F@UBmBB CAA CDA CBCBBCB   D8k ABAACEE@Al @A@B|kpL AD(A*B"B&D$JECC}@W @DGE@L @H@E @D@K @I@E @D@L @A@B @A@ k AAAEC@@ @A p BAD A@B p A0A@BD E 4p` AAP$ AACA@ABG EC(p@ A@A BI A@N{E0pB0 APA BDACG@ C @R@ $pC AA@HB_$C"$pF0 AA@K| @$pG AAG@AABHpJ ABF B"B$FBJG@A @K@s @IFJ@pM4 B AD@pM@d E0AJ@ XpM ACBA BBADN@(| @C @(HpO@@ A`BAFj@ D @r@ f @P@ L @D@ G @Q@ D @0pR< APa@S @G@C @A@B @E@$pSl A@AC@S @DpT0h AB*AA"C(A&C$CFAA@h @M@@ @A(y U, BPA BCA@CE Ey VP A0A BE@ 8y W  B0A EB@ K @A@ K @C@ B\ @$y X0H B0A A@ AK @Ty X AA@BBCABICA A AIE  I(y [ C0B ^@L @C@G @(y \ APAAAA AA C@py \ ApABBCC@CCHDC DB E  @Cp  @<y `@ A@A B BKA@\A @L@D @HFAy ad ,y b@X A0BCA F@ O @n@ F @4y c APA AAB CBP@D @E@W @ y d A0A@ BDA $y epx D0A F@ B @H@ Hy e0 AAAB BC"C@CJaHJA B }F[hy i  B`A AB GCA@AAp @E@_ @FB@AA@ @Fy l y m 8 CPFBP(y n` AA@ABB CC(y p@ AA@ABB CC$y r0d A@AAC A C@(y t APAAAA C AC@ y xP E@iF@YC@0y z0 ADBCA@G A IBA y }Px B`AAC s@ Py ~ BABE@D BAAAB CMA AAAA0y  AAAAAAA BAA@ \y  A`AAAAA A AAB@ @C` @Py @ BPAO AAAC@ t @F@ h @DAA AAACA@ y ` $y p B@ABC A@C y P A@A C AQ@y @8 B0A D@ $y  A0C A E@f @C@(y ` B@ACE@ H @F@ E @(y P B@A EBg@W @E@ y @\ A0D A H@E @(y  A@A A ADAC@y ( @ @A` AA@CCAI[ B FBPP @A  @e$ AAB DB@C p@ l B@A E@   0 @p C@U( IpCP@E @O@E @ , A@C A E@GY @C@4p A`A CA@ HGABfMP4 A`A CA@ HGBsMP@ @A  AA@ACD$| C@B p@K @M@@ @A , CPA BEB@,`P ,( , ACA BB H@IU&H"F(C*DQA(A*lE*("&dRA(A*LH*("&NZ*([GBNA&A(A*B"\U&A"AA(A*A&A"CTK*(QB,\ B0AE@ A $,P B0C A T@T @G@(,@ D`BG K@ q @A@ ,, B@B C HB@d @D@0,< BPAC H@BCr @C@,,0 FPB A S@A @K@\ @C@@ @A, AA@ CCAG UP $  APL@ s @BP@  A`CBE@h @ D@A L@l A@A CH@ p A@A BB F@Ȁ A@CAC@ ` 0p ABABH@E @w@J @V@$p A0C A L@D @F@8 AAABEAM@E @H@x @G@ΰX D BK@ C@$l C AK@D @C@$Ѐ B@A E@ V @@ @A, AA@ CCAG UP , AE@AFo Q Tt p A`CBE@ۀh  A@CAC@  , ACABH@C @I@M @$P A0C A L@D @F@$ ABDAV@V @$@ AA$C"C L@L @$ B@A E@ V @l ApACH@@ @A0` AA@ACBBH GQ `P B@A DB@ B| A@D@ D0 A@ADA F@ C @CB@ D @E@ C @D@ C @C@   ApI AA@AAAA ACA @E@C A AAAAAAAL @B  @ 0 ApAMD@DH SG @(8 A`B ABBCB@ @ 0( EBB s@ Q @A@ Mm[ @B@ B @`@ @ @A`@ APA@B` AA&A*A,A$B"H F@(PACQuMvZFeL AAA CE A@QLNABAQYABB4 A AA"AAD C@CDAE @ @A$4 B AD@$ ABFBL YACJ@B Vl @D@H s @E  @O @A@G wEOE ,$% APCA S@| @C@G @C@@ @A( A`YO@)4 B0A D@ * AEB@CA- .8 @.P ApAA DBF@AABK @C@C@ @AD/X ApAAF AKCp I@AAAC1P APC@ C E1 2 L2 X A`ADEBBA@ A Ab @LB@ H @E@ T3` ABAAFBIJ@U @F@a @C@CD @A@d @E@DP5 AA@ECAIDS C^OP ExY e< EpA EA@ @ @A<=D AABAC CCK@K @c@D @B@4> A`A EXA` R@ H @B@ 4? ApA@ AAAACDCG E0Ap APAABD B G@l @B@\BP A BAAADDCQ@_ @CN@ @G@U @A@rRS @B@FE AA@E CB"BHCW DA DBON @C  "@yBA A[MHLHMH  tAcAtADVpx ACACC A@A Ac @A A A@AD$W A@AB BD A@Y A0B D a@Y< B0A E@ 0Zh AA AABBE@K nB [D ABHAaA@H @K@M @B@k @CG@O @F@M @F@HY @ ^ A@A BB D@@ @A,_ BJB@CwRKBXa D A GBAxA  _@Y @N@G @E@f @L@S @Xe  AAE A JIGB Z@_ @C@G @C@H @C@i D0A I@Hjl A"AAC@ FA"IACA u r EB O@ t AA@ BA Bupl B0C B O@Du AA$ADBCR@B BAA\ @C@<x AABABFC@ KAB AE@ @A0y BpAB@ C AFDGFx{P AA@A A"AABBECF.A( @C "(.@JF.($~@ B@A F D@M @F@( B@ADA D@\ @C@\ BAD@@ @A8,`< AY@E a aM Wa S} ND X(,` AAD"AAD$N@,,` B0AE@ A @ @A8` A`ABBCH@R Q K @C@< + AA*C0C$C(C&A,C C"C.C@ KOV, A@ACA C C@Z @E@0 AIB@( A@AC AC@ DVp AA C AIA$B&ABB@(t @L@(C @E&$@(K @E&$@(t B@DA OE@ @E@ R @G@ N @DD@ E @DD@ E @L@ ]BC @D@ D @G@ OƠH C BH@ BPACl@D B@ADC A BC@P @H@J @C@C A H BAJ@ CC@ ɰ HPBABC@ ˠ ,pL ApAAY@ T @O@ L @C@ 0 AABDA@H @E@D, AG@(X ApAABBC@E B P B@AB CA@ 4` BC p@G @d@O @R@Z @j@0( D`F BBEC G@Z @H@H  APC BEL n@D @JBD A@D @F A@H @ 0 A0C A J@b @ A0A@ BA 0\ A`AABh@ D @L@ I @G@ px F0A M@ F @ \ A0C A I@D @P`   L@F@ @I@(P AABB@GvE$0 A@AA DK@ X @@ @A$ ApA@BCBB( BBCD@D @B@  AEBDA@Dp A@ADA F@ E @E@ C @D@ C @E@ D @E@ D @P, ( BAABBDC@(pX F0A {@ B @B@ H @` D0A K@ 0 P| CpA R@t E@B@CPd C0A@ C ( BABBC B@C @ @AP` I0B N@ B @E@ I @N@ B @Q@ B @D@ B @F@ B @B@ B @  AEBCBC:R"D E@,A*B&A$B(D< @46C&($ *"@,:<_ @6B$A@,A&A(A*A<H AA CBE@ABBBAB D @8:<>< P AAAABB CC@I CAJX  AAABABCGH@ t @468:<>B@   <T AA A AAAAABAB CC@} @p t0 AB*E,B2C.B0C(J"qA"N@ ADBBAABG @468:AA$AC"C@ML BCGC D J8:<>8 AAC$A B"B(B.D&B@HF2F4F( H AC@AADBE@ @A$"@ ApA@BCBB(#X BBCD@p @B@ %P BFBDA@ 'P B@A DA@A (x )4 BpADA@$* I0F U@ B @B@ + $,0 H@CQ@B @C@,L A0A@ C - -@t A0A BF@ - B0A BC@ A@ @ALp.P ApABCBBCf`AB@A @G@n @B@Y @B@p1@@ AABABDAO@ L @H@ D @A@ EA"A$E @AA"A$A@ o @J@ M @A"FC$B@ A` @D@ L"$G @ p4, AEBDA@Tp7 A@ADA F@ C @D@ C @D@ C @E@ D @D@ C @E@ C @E@ C @Hp8 HACK@AAW @AA A AAAAB@A`p< AA(A&D$B"XFAAAAD@ X @B@ J @G@ BI @D@ Dp?` BF@C*B,OA@I @BCCFA@AB"B BAA @68AAAAA@AA"A { @68A@BH" @pE BABDCO A@I @A@A u @A@B <pG ApAAAAFBCL@F @R@E @U@$pI` C0B a@ @C@ pK  AA@CCApL B`ADB@xpMPd ApACAEJHD@ A AA @46DCE@ EB { @46H@ D BI @46A@ I BPpP AAADBS A@] @D@E  @G @O @C@E pT` A@A B B@@ @A$<U ApA@BCBB(<VX BBCD@p @B@ <X , AEBDA@(<YP\ C@AE@ D @D@ C @(<Y N@CB B F@\ @I@<[p AHN@$<\0 I0F R@ B @A@ <\ <]T C@A@B<]L A0A@ C 4<^@ BAA AECCI@W @I@@ @A_@ _P ` `x A@C G@ apD B AF@a Da, BAFC@OADAadEBBF e| C@BN@G @@ @A$e ApA@BCBB(gpX BBCD@p @B@,h AADABBDB@ k A@ADA C@ l\ A0BA@ |mt AB(A D&D$B"J@CA @CDDCF@D @EABBD@n @G@^DO(r` ApA A BCBDA@$t BpBBHCM@ $uh D0A K@ H @v` E0A U@ wT C@A@Bw`L A0A@ C (w BBCBBCB@{P( ,{ CPBLBO@J @|@ AF M@ @ @A$` B W@AAA B4 EB I@ $@p ABCBC A@ @ AI(A&L@OAN"C CJAEGP AF J@ ` < ACDAKAD@KO CBa, APC A@U @CP @, BA BD@ C\|R@ @A$ ApA@BCBB(PX BBCD@p @B@ 0 AEBDA@< A@ADA G@ C @E@ D @D@ C @E@ D @( N@C B BE@b @I@8pd AADAHPD@E @A@k @$ I0F R@ B @A@  @T C@A@BL A0A@ C $ AAAD BH@gACB ABkI] @G @NG T@ @A 8 B0A E@ `8 B0A E@  AE$B&C*C(HAA,ADAH@O @K@o @A,*&($@X @F@O @G@L,< AA@ CCAGaPS TX wV MPp C0AB E@ $8 DpCC@C @E@0$ B@A A EW@M @F@L @E@L0 BPCCEBt@H @G@I @G@D @A@M @`@G @F@( B0AD A F@H @H@ ` B0A DA@ A H C BG@C @@ @A<X` BABCAH@ C CQ X @D@ L X  A@A F@B$X0 B0A FA@ P @X A@A F@hXp CABJ@J @CA@AABAA A  @AAAAA@A AB <X A`A AA AABAEAF@ @E@PX B0D A KD@H @ECI@F @AJ@ @E@U @CI@X D0A J@X@ C BY@ X A0A G AC@@ @A@۰@ AAA,A A(AAA.A@*ALD FO4@ AAA@B A&A$A"_ CCC@ @A8 0h ApABCACI@_ @B@C @B@(  BBCD@D @B@  AEBDA@T   A@ADA F@ C @E@ D @D@ C @E@ D @D@ C @E@ D @E@ D @, @ DPA J@B @C@b }>E 8 0 BAABBD C@\BCIBd  DAJODL@ G @UABAG@ P @T@ E c @6A@ E x6F `6D L6D x ( AADAH D@ CA"BA$L @468:<>A C@ "$d @468<>A@ BA"AA$B  t E@B@C  Pd C0A@ C P   BACA@ AAAX B @468:p A0A@ B A$ؘ ? D`BQ@V @D@@ @A8 @ BPA BDAB O@t @H@B @B@ B4 B0A D@ ( C  A`A@ AADAC( F BPAEF@ K @H( F A`CBBI@ \ @C@ 4 Gp CpBBM@B p @C@J @C@  I BPAEAY@ ( I| B@AEE@ J @F JP L AB*A(E&C,METABA@Cm @@N @B@K @BC@D @C@SABBJ @B@fk @]@D @s@( T@ APA AAB@ CB@ U APABA@A C  @BP  @ Xpt AB&IDGG V@A"AAF$C  @A@A @C@A$CA"BA D  @A$ " &@U @BA@DD$ " [ @d `0 AABCBCCBF@A AA [E A AE @B@AE @@ @A4 c C@B E@ E @C@ I @HB@ @  c` , dP$ D BZ@M @A@M @A@ ed BPAEA@( e C0B T@ B @B@ C @, f0 B@ABCB A@A s @ g A0BB@ D h BABCA@ED A AAABB j  k l A0A@B B( l A@A D AH@X @K@( mp A`AA@ AFAC  o A`ACB D@ q  q   q0  q@T C@A DA@  q   q A0I@ E @f@  rl B0A AD@ N @  sp B CD@P @  s APC A B@M$ v A`ABL@c R0 xP BpACK@ ]A HC HL4 zP A@C AF@ I @I@ I @A@ O @A@ 4 {P AAA"AA@$AA BA&CC< @$ A0C A F@I @N@A @E@I @A@M @B@0 p D@AAB DA@ N @H@ D @  B@AB@   AACA EDO@C @y@C @R@B @F@H @H@`DAAD @fF~@S @r@8  AACA BCECCG@W @K@$ B@B J@Q @ID `x B0BD@ H @J@ R @D0@ Z @A@ G @E@ , A@CAF@ I @G@ R @A@ P  A`BB BFEB@AP @J@r @AE@8 , A`A@BD ABBGCB j4 H A`A@B DBB SBGNU4  APD AF@ I @O@ H @D@ b @B@ 0  A`DAF@ I @F@  @A@ 4 @T A@C A C@y @B@ @  X C BG@D @   0  @0  p ,  AA@BABuF QR< @, AAAEBH@D @A@T U @A@E ( p X AEAP@D @C@4 A`AAAABACC@ A b @   B@AB CA@  C0A E B@$ B0B B L@N @C@, 0 APDA]@ @C@ G @E@ $ @, A`E Ai@ B @A@ ( p B0C Q@ B @A@ N @(  A`AAABBC@ $ @ B@BB BB D@,  A`BCBBF@ Q @C@ ,  AA@ BCAF JP D Рh BCCAE@ P @F@ d @B@ @  ABABDEO@I @E@N @B@X @A@T  BpB B CCG@A` @A@tMM]SJ @B@HE ߰8 A A@B$ ( A AW@] @F@@ @A$8 EB@A] @8 @ CC@H @8 8 T AA@B8 p B0AD A@48  B`ADA B@ HABAk8 @ B0A D A@8 L C0A I@ $8 l BANBB@8 4 B AD@(8 \ B AD@CH @ 8 0t B0AB CA@ 48 0 B@AD B A]@D @A@V @D@8 A0CA P@8 p\ C0B L@$8 t B0A OB0 B@8 P4 B0A D@ 8 A@A@CB B 8 @T A@A@B 8 8  BJABCCF DB AEB@U @AA@ @C  @S @B A@DD 8 h B0AD A@ 8 x B0A E P@8 4 B0A D@ 8 A@A@CB B ,8 B@AE GB@ C@ 8  08 0 AADAF@D a @B B@ 8 @ BPAB CB@ $8 p B0A NB0 B@ 8 @ A@A@CB B (8 x B@AEE@ J @E8 ` P8 4 BADAFC[ D@ \ @C@ ACC R @B G@ 8 t BPAB CA@ $8 @p B0A NB0 B@8 4 B0A D@ 8 A@A@CB B ,8 B@AE GB@ C@ 8  8 0H C0B I@ 8  @ @A B A@ B A@ B A@ B A@  B0A@  0 B0A BC A@$ h B@AF@ O @$ Ph B@AF@ O @  B0A B@ CA ` B@A DA@ h D CB@ p(    A`CB CA@   AA@ D B t BPAC@ @ BPAB@ @< A`B AB@   ApEE@  0T AA BF@ (  BPA CH@Ao @ B0A E A@$ P B@B D@\ @D@, ` APA@ B d @BP @  0 APA@ B  t B0ABC@ A L `, AF BAd@ E @D@ I @D@ v @C@ D @D@ @ @E@  \ C BB@  $ @ ACFAC@G , @ APAA BC@n @   ApA@B$ 0 BPABC A@ B$  AA@Bq @  X ApAB B@ G4 ` D@CA G@JYW @D@J @C@0 @ ApCEA@u @Bp@p !P@ AD CAFABB@ A\ @BAAAG@ BDC|G @AAA@ @A,| $ BAMAZ@ D @a@ ^ ,| ) < AABBC A@ LC| ,` | ,  | ,x A0ABB@ D @ @AH - d KB@H -H B AF@(H - B`AB@CAF T$H /| B AQ@B @A@,H 0 C0B K@I @E@Q @C@$H 1 C0A G@W @C@$H 1 C@A G@D i @H 2 B@A D@A(H 3 APAA@BBC A C,H 4 B0AFC B@Bi @4H 50 ACCAH@ | @A@ c @F@ H = A@E@,H > A0B D F@AB @I@A$H ?p C AD@B @K@4H ? A@CAC C@ AA\I @A@ @ @A @  CR$C,C.C(A"E&A*t@B @B@e @F@QKAEU @E@{YFcg I< B0A F@ 8 J  ApAA AABBDC@K E L M ApAAACDCF G@ A @I@ c @C@ A E @C@ 0 Pp APBEBBZ@ J @O@ V @( Q AD@B A ABB$ T8 B@CAG@ h @D@  U@ B0A G@ x V0 AB$B"AB CFAFM@D @B@OMF @BA@CCs @A@CCD\ Z ADABDC FG@A @I@jtHnS @C@AEW @C@DL a4 ApBKY@ D @i@ C @L@ U @F@ F @G@ D @Y@ I @Q@ , e  AF@BAAAABB, i@ AADHA@J]M( jt A`A BBD@I ]M ( lP| ApACBD@I ]M  m< B0A F@ 4 nL AAABCEC@C FJ q`H B@AI@$ q ApCH@[ @ r`H B@AI@< rd AACGB@e @A@ t H B@AI@  tp B`ABFB@< u@ A`CC A E@AAAAp @F@L v| B`CC AGA@BBWKJ @F@I @C@p x@ ABC BBE@DOBvXBGnBA ZH @F@JEEE$ }0 AABB DA@`  AA"CB BN@A&o @A@D&GJGLs]B`L0  ACEA@IABP ` ApDF@<  BPACN@ J @F@ D @H@ E @F@ I @A@ D X ApC CAK@AAAABh @L@l p AAAAAAB CACC C@~ @A  @x  AAAC BB C@VABACGP @C  @jL `8 ABBBCO ~A@B @AA@Z @A@B @B@ D BA@ | C`CA@  p` B0A A C@N @8  BABCA@B ODAA AB8  AAAA AAABD ACB@P `d ACAB@GD DAAABIBAAAA$ B0A B X@F @K@$ A`AAABB@@ @A `H DC@    8 d B`AEAEL@ H @o@  @C@ C0 P B0A D b@B @A@I @C@  @ C AW@C @T  BpADEA@H @G@IN B BqG @C@DI @@ @A<l  B`ADA@BY A ABBA,l B@ACI@ AA S @4l p BAEA@] @B@(l @ A`A DA L@AC4l @ A`EAF@ Y @B`B@ $l C@A F@X @C@$l C@AF@ N @D@ pl @@ ApCAG@ C @D@ ABA KBMBAIAlcAAsF Dl  l X C BJ@,l  B`ABCB@DB A cl P ApFJ@ l @\ A`FJ@ l   AHJ@,l p AHJ@r @D@Dl P8 AA$CC"A CF AAAB@l @C@l ǐX AA&AE,C(B*B$HAAAB@ @A,(*&$@\ @D@I$l  AABB DA@0l B@AD B@X @B@ @$l ΰ B@AF@ ` @l `H 8l ϰ APBABJ@ I @J@ E @G@ H @A@ l Рd B0A E@Dl , A@AD AF@ J @J@ C @F@ AAN @C@ l @H C BI@0l Ґ BPAB CB@KACID l @l CA B CA@ l ذ A`A B EB@ l ڠ A`A B EB@ l ܠ A`A B EB@l ހ BPA BD@ l p BPA BD@ l ` BPA BD@ l ` AABC&C A$C"F A AAC@` @B &  $"@\ @C@H  l P C@A EA@l PP C@A EA@Tl $ AAACBBI@ X_ @I@ QDX| ABy 4l  AABBC B@LtDIHDl d AA BEAN@F @C@Xe @BB@_Ll APE@BB$l C0A U@G @H@l @4 B AD@(l  A`A AABG@C(l 0 AAAIB@CAl P C0AE A@ l `P C0AE A@ l  l  @ @Ah AE2GBd A@AA AAt @AA@A @B@BBIO {OD {F DXA ABB 6^B @C  @D @8h  BAB@ CB"BE$OA CA CTh p AA@BABBFDJAA B eM  ^h `` C0B B M@Th  B`AACAFA@A BAA o @A@CBTJ @4h p ApAAAAA A ABNO@Hh ` B ADAD@ CTA AjRL  @E@ KE h 8 B AE@h  A@A@CD h  B0AD A@ lh p AA$AB A(B.D@,B*sAAoAA AAABB Ge] YLh 0 A`AAAACCF@ A AAA @Ih  AABCBBC ABD@b @A AAV@D @C@D @HA @e @HB C@D @C@8h !@ AANAAAAAEFCLAJD@HLDHh 4P ABCBBCDABCAg@e @M@Q @G@h 7 | BH0B&A$B"D G*A,A.BB*A,A.C4A@6 @C&, "4.*$0@6b @B&, "4.*$0@6lh > BAAAAA@G0C(C"C$A*C,x @A*0($",@4h G0H AA@DC&A(AA"AB$C Clh K 8 AA(E C"C*CF&AEA$CV@^ @B@M @K@b @B@s @D@ @C@ @A@4h Xt ACBCBCR@b @H@D @8h Z@ l BD$A&AAAAA(CBF8D@4h ct ACBCBCR@b @H@D @Lh e0 $ AC.B,A"A*A&A B$B@(P2CFIPa0h n` BAAA@ABB0D.CClh vp AJ2A:A0A4A6V@D8LCBQhQKAALDEL4h  A`AA AA ACBCB@C4h P A@CAC C@ AANI @A@ 8h BGA:AA>A8A4ADBFC@ 8h T BAL"AA@AAARAC BHH@b4h @ AGE$AA@A BBRECNC",h  AAA@*A AABEC@h H CAB*A4AAA.ABE@,^qrR`h , BAABCB$B"C CS@UL @G@B @I@[ @GR@LR @D@,h 0 AAAAA@ BAABh t $h `T D@C B {@H @8h  AAABBCB@LDeDT h Ɛ A@A CBF@h P B@ABC@4h L A`A AABe@ D @A@ Y @C@ 4h 0 APBATBPD@ D @D@ h $ 4h  B A*A(A$AAAAABD@& h ΰ@ B AD@F @$h  BPB AB K@Z @$h  BpCBBE@ i @h   h @ A@ACBE@ h @ C BE@C @0h 0, B@AKM@ D @O@ D @L@ D @@h `$ A`BCBB BBH@ g @GA@ E @@ @A8x א AACCACJ@ Z @F@ K @C@ x @ A`BCAC@ ,x  ABCBBF@O @B@,x  ABCBB G@ _ @E@ ,x  A`BC BBF@ Q @C@ x B`C AC@ x ` B@CAC@ Hx p AAC CA Q@ @F@L @BB@LBBhx P BpCAC@ <x @ AA@ACCACR YR Gc aR x Pd ApB CAC@ 8x P B`CCAQ@ O @F@ | @B@ O @D@ $x  B@AD B@ EJ x A@AB D@ Bx h B D@(x $ AA@EAF Apx l A0C A C@x  AEBCACF&A@(AAAAq @A&@(m @C&@(J @A&AAA@(AApx  AA CCCJ@ `AAA$A"Bx @F@ Q"$N{"$@ @A(! l B AG@E @D@D @!   A@A@ BA ,!  B0A J R@Q @P@M @B@8!  AA BBCB@O G F F D! ` B`A A BBDABA@A{ @DB@DH!  ApA B AC@FEAAABCGAA!  AABAEA@QRGABO AB EAA A JG lY GDDAXCDDD K @C@ANC!  AA B BD@"LAAAAB BQAAAABA BAAAABA B4! ` ABFC@ ] @C@ L! 0 B@A FBI@ ` @BBC@ O @A@ B @C@ E @B@ ! ( APABAC@ `! 8 AA@C$C BD"NABBA Ei C! $@ P! $ ABAABCC GBDA D@AAV @A@AA@ @A % .h D0B H@ H @% /0 AA@D A G\ AABBBC @A   @LM nJ 0% 3x CPC CAK@ I @C@ B @B@ 0% 5P BCAH@ Y @E@ H @B@ % 6@\ C@AK@ % 6h D0B H@ H @4% 7p APA CCAL@ L @F@ J @B@ 4% 8< BCAG@FUBF @F@H,% 9 D@BJ@ G @C@ I @A@ \% :T ABCBBG@AGJAB ZU @F@J @B@GVMp% <t A A@D&C(A*L ^R pG fG fL VX UY JI sG tƑ yr xP T % Np A`AAB C@ % R  % R ABCAC@t% T t AA2A>B8C B`A BB@D>` ApAABBI@S\J CF @AA@w (>l APABAB@ HA,>` APC B@W @BP @>0 C`CME@]D NGC @C@E @D@E @D@I @C@OC B G @E@I @C@H @C@H @B@FX CDBGD MTK L>4 >0 >@ $> B0CAB@ Y @>°L A M@T>l A`B B BL@I @DA@\ @AJ@H @F@U @B@[ @C@I>p$ D@AB D@ >Ơ` ApAA AB@EIDFG @Bp @]^KMABMQGD> A@A AFA L@AN @H@AO @B@F @l@>\ >@ >` @ @AA΀T DC@A 0A BPAB@ DS @BP@ $Aϐ B0A _@ B @A@ $AP B0A DA u@D @HA` BPADAD BC AC@_ @HC@C A A(AҀ B@AD A@R EGA0L BAL@AԀ` B0A D M@,A B0A D [@D @C@E @C@8A\ BPAD A B@V`vRGFDA  B0AD C G@HBC @E@E @C@C @ @A,C ApAAABBAC C@,Cܰ ApB CBBF@ Q @C@ Cް A`A@ CCA CP BPBA@ ] bC B@BA@ Cx B0B A@ 0Cp, AABB@FA iP FC B0B A@ (C` A`BAB@` TP C B@BA@ C ApAB B@ Cx C0C@ $C B@C D@ Y @C@ C B@BA@ ,C B0C I@ G @C@ K @A@ C` BCD@BE @DD@DCBF A DBL ^ @AG@ C C0H@ F @F@ C B@BA@ HC0 AAABB@SJA ACM eL$C B0B G@ G @H@ Cpl C0C@ C B@BA@ (C AABB@F ^hC BCCAF@ABTNCCA B B @A@ABE f C` A`BCAC@ C AA@BCACh A@D J@ C B@C AC@ C A`BCAC@ 8Ct ApCCAEC@B ^ @F@I 0C Px AB CBB H@` @G@UtC  AA B BDA@NIAAA CIX QOK v0Cx AAAA AC AC@Yb0C@( APAABO@ E i @E @ LCp AFN@ O @J@  @C@ R @C@ Z @D@ d @F@ $Cp B@AD BD C@@ @A J0D B AF@E @ JH B AG@E @ J B0A D AB@$J BAF@j @C@J BADA@KAAC KDCDA CULAAAAA W^AAAAB D IMAAAAJ# B0A DA@J$  AF@F@ @ALh'  APA@ BF 8Lh(  AA AAAAAAAABH@ Lh,  AA@BCA H$YP$JBKABrA{lJVBCEBifBGZBTBkB[BLh:\ B0B@ 4Lh:`< BpAEB@EA ABB iLh; H h@Lh<, @ @AN = FFCBBF@\ @F@g AC AA~A AAdU  XJ  \V  (N G A`A ABBCBC@LN I` BPABE BAC@[ @FB@H G AB\F(N K@\ B0A DA@ AK @(N K B0A EAA@ S @@ @A OL H B AF@F @4OLpL B0A DT@U @QC0 B@,OM B AS@F @^@D @A@4ON B0A B CW@E @A@I @F@C @@ @A4PtOH ABC$C(A"C&C U@ @C@4PtV0 A`ABBACF A@ N @I @ @PtW AEEBR@B @AE@E"B AI$A(C&PtY8 B AE@`PtZ  ApABCCBLAAE@ U @KDp@ U @B@ Pt[@ B0A G@ ,Pt[ APA BBBC@ E @PPt^ ABCACCACA A AA@U @C@ACdPt`P` ApABBBCC@AANJAA A Aa @A@H @hPtb( AAB BBCC"AD@\D"M AACfR BC @C@",Pted F0CAW@ Q @\@ F @\PthP BPCCAT@ E @A@ E @h@ C @I@ O @A@ F @M@ D @H@ N @A@ E @Ptj D0A I@4Ptk D0CD N@ @A@I @T@F @F@\Ptl` B@CAE O@I @N@C @B@C p @E A@F @M@C @H@F @A@,Pto AAAAAI@B DA",Ptpx A@BD A C@^ACXHPtrPX B@B AH@D C @F@D @A J@[ @C@H @A@dPts A0D A H@EA @f@C @F@E @BB@ @A@E @M@D @H@G @A@E @TPtu A0A DB Q@H @N@C @A@Q @A@F @M@D @H@G @A@E @,Ptwp AA@IAAAC B$Ptx@ A@AB B E@C,PtxT A`AAA BBCA@C Pt{P APAB BD@ Pt| 4 Pt|`l B@A E@ Pt| <Pt| APBABBK A@ R @E@ E E @ Pt BPA BC B@8Pt A@A E CF@P @GB@ @Ptl A0D A O@ PtP B@A BCA@(Pt  A@A EA I@^ @B@Pt C0AB E@ Pt`8 B AE@0Pt B@AB E@a @B@ @@Ptp FBN@c @BD@j @B@Pt` Pt@ C0B D p@PtP <Ptpd A`CFI E@ ^ @FB`B@ A @ @AdY<| AA@&AC BBAAAFdDSY_BCABBZBAAABMF^oAABB^_iaqn|BNZSHY<` D0]@ E @$Y<0 APAF@ ] @C@ HY< B Q@G @F@F @F@F @H@G @I@G @C@E @B@@ @A([X@` ApAB BN@BBB[X [X` B0AD A@ 0[X  A`ABAE@A @E@LA C 0[X AD E@ ]kaRDIx[X AAAAABC@M AB As @B  @|P  [XP APF A@ ,[X0 ApAA@AAAB DA4[X h AA&A"AA(AA F*BE@$C,[X BpCC@M @D@c @E@D $[Xp ApAABBC@ $[XĐ B@C D@ ` @E@ 0[Xŀ AA@CAK KoM B$[Xp, A`CBF@ M @B@ $[Xʠ, A`CBF@ M @B@ \[X BCG@DENBBA GK R @E@G @C@[X AA@ E[X`t A@A@ B A$[XH B@C D@ f @E@ <[X0 BCE@K @A@SH AABg[X A`A@ BA[X APBAB@ [X| A`A@ BA0[XP` A`ABD@CSFJ d[Xݰ APABF@ $[Xp4 C@B N@ j @D@ [X@ APABA@J [X` A`A@ BCA([XPT ApBCAE@z @F@,[X ApACA@CJBT [X4 ABAB@R$[X ApCBD@O @C@$[XP ApCBD@O @C@[X ApA@B[X B@AA@ [X( AA@CB[X A`A@C,[X A`B CBBE@ G @F@ [X` B0A E@ B\[X AAAAAABBG@ P dnYA ߔ KD FsFEih 0[X8 APA ABBE@Q B\,[X A`AB BCB@F ANL[X04 A`BABH C@LB  @AA@A A c @C@ [X p B0AD A@ B[X ` $[X BPACJ@ P @E@ $[X 0 B@AC I@P @E@[X l B BJ@<[X P BACR@NBABVU @E@([X BACR@T @E@@[X BA C"M@PLMBSG @E@G([Xl BACM@] @E@@ @A$d0T B0A D@L @d B0AD A@8d0P ApB ABEA@ Gs @B@ AD$d B@A E@] @d p D0B L@ dl AHBDA@d0 AAD@0d04 B0C CA L@^ @E@K @C@Hdp AA"ABB CC@k @B" @0dH BADB@NACB A B8d A@CAG B@ T @D B@ N @E @ 0d A@BD A G@H @E@D @C@$d p A@DF@ O @$d p A@DF@ O @0d!` A0A CB J@I @F@E @G@d"@P $d"| APABAB C@Hd# BpCAG@_D BDA[H @F@S AA@ @A$h$l AA CBCA@h&` B@A G@h' B`A F@h' BCAI@G @F@Q @_BK@I @I@R @BG@L @B@Z @B@w @B@Z @B@Z @B@ h, A g@H @A@@ @A4i-p@ BPADA@KC BFC Dw \i/ BADA@EA AAABAC UAA A AAAA(i3 A@ACAC@ D V(i4\ B0AD A@ M @$i4 B AV@B @D@i5H B0AD A@ $i5 B ABC@ENi6p  i6d APBC AC@ i8 0i8\ APCCAF@k Z @A@A @ @A k9p` AA@ BCAHk@ A`C EBT@ L @S@ I @GB` @ D @F@ $kB AACBBC@kDP| B AE@kD0 HkE AABC CAC"F A AB@} @C@H dkG ADA@ABB D CCCCnE uAAAAkO@L C BJ@HkO B@AG C A@AYH @B A@C @B@C kP A0D A F@^ @@ @AmQPx B0AD A@ mQ,  mR B0A DE@ [ @,mR B AJ@B @L@A @B@mS@ @ @AlnpS` AABEOBAAA&F@Hh @A&@npV( npV@P B AD@npV8 B AE@@npV AABBCA@MAB BBA r@ @AoX\ @ @APoX0 AA$A A&AA(A"A*EBDA@ @(o\0 ApAB@BBDAo]@ AAAAAAA ACBD A@F @C @[ @B @$o_ A@A@B CGE `o`h ACB FAAAAADbA@AC @D@pnB @E@FVG0oe0 ApA@AAAB BCC Cog B r@E @(oh B`A@AAA BC DPoj  ACCBEWME@S @KE@N @y@w @C@D @M@(om| A0C A K@M @$on`p B0A D@S @@ @Arn  rn BAB@C$@ @Aso8 A0A@ B sp08 A0A@ B $spp0 ABBCC@ C lss ABBBD@IGABB B ET  VO  dsv( AA@BBECC K B GAGhT  FH   sy| A SBA@LsPH ApBAA F@AAAY @AA@AAe @s< AB D@ s AAB BC A@\EABABoG\NTDyABTEDAAA@ @Au B0A D@uX B AE@0u ApAABB@Q yF KJ uP B AD@u0 B0A E@ u BA BCA@ u BAE A@ 0ux AACBE@A G @A@A 4u BPCAR@E @B@I @B@I @B@,u BPCAS@D @F@K @A@u APC C@(u\ BAFB@G VB (u \ BAFB@G VB (u BA F B@k @0u` B`A BDA@H PK WJ 0u| B`A BDA@H PH WG u BPA F@ uPL B AD@@ @A8x ECB[@I @P@L @D@T @F@(x A@A A BBC@U @4x APA BBCAAC@A d @\x A B"B&B$B CD@A CA CA @V@F @CA@d @E@hx P AM>A6B@B:B AAB A@J [D @ @A@@ @P$ @A F@F @A@_ @Bt@K @C@H @G@$E A AC@] @F0 APDB@LF ApEAA B A@D @C @M @xH ABA D@ABT` ABG AEAe @B @F @B  @{F @C  @J @B AA@B LD ADl @B  @J @B  @x @B  @J @$N  A0h@F @yC04Q A`C B@ Cf @C` @ lS ( ApAAAAAA AABB@G  @Bp  @x@  @`` l , 8p@@\  @`@00@8`P@8p<P@P ,X0@TP ,X0@,0@$D @\@  0 d|P Px@  @,\ h0@x@  @0 P0@@ @Aas::7.2.1:crt1text.xas::7.2.1:crt1tinit.xld32::7.2.1:as::7.2.1:tcrtbegin.oas::7.2.1:stubs.oas::7.2.1:tkAppInit.obe::7.2.1-1274714010:tkWindow.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixDialog.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkOption.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkFont.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkImgPhoto.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixFont.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkConfig.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tk3d.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkButton.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkImage.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkGet.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixXId.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkBind.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnix3d.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkColor.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixColor.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkBitmap.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixSend.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkAtom.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onas::7.2.1:tkUnixInit.obe::7.2.1-1274714010:tkEvent.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkGrab.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixEvent.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixWm.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkGeometry.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkGC.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCmds.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkGrid.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkVisual.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkFocus.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixEmbed.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixFocus.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkPack.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkMenu.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkMenuDraw.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixMenu.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkText.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextDisp.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextBTree.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextMark.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixDraw.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextIndex.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextWind.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextImage.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTextTag.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkImgPPM.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixButton.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUtil.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkClipboard.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkSelect.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixSelect.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCursor.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixCursor.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvas.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkRectOval.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkTrig.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvWind.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvLine.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvImg.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvUtil.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvText.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvPs.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvBmap.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkFrame.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkPlace.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkArgv.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvArc.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkScale.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixScale.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnix.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkMenubutton.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixMenubu.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkMessage.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkListbox.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkError.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkCanvPoly.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkImgBmap.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkScrollbar.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkUnixScrlbr.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkMain.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkImgGIF.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tkEntry.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclListObj.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclIO.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclObj.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixChan.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclIOUtil.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclTimer.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclVar.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixNotfy.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclBasic.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclCompile.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclIOCmd.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclFileName.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclCmdAH.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclCmdMZ.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclExecute.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclNamesp.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclGet.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:regexp.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclNotify.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclCmdIL.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixFile.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclPkg.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclLoad.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclPreserve.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUtil.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclBinary.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclInterp.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixPipe.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclLink.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclEvent.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclProc.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclAsync.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclIndexObj.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclMtherr.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclParse.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:panic.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclFCmd.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixFCmd.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclPipe.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclPosixStr.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclStringObj.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclCkalloc.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclHash.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixEvent.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onas::7.2.1:tclUnixInit.obe::7.2.1-1274714010:tclUnixTime.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onas::7.2.1:tclLoadNone.obe::7.2.1-1274714010:tclIOSock.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclEnv.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclUnixSock.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclHistory.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclCompExpr.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclClock.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onbe::7.2.1-1274714010:tclDate.obe-options:::-PHASE:l:w:c -G8 -TENV:PIC -m1 -O3 -TARG:abi=n32:isa=mips4 -TARG:proc=r10000 -LANG:=ansi_c -TARG:t5_ll_sc_bug=onas::7.2.1:wnrtl.oas::7.2.1:search.oas::7.2.1:wnutil.oas::7.2.1:wnglobal.oas::7.2.1:binsrch.oas::7.2.1:morph.oas::7.2.1:wnhelp.oas::7.2.1:frame.oas::7.2.1:_eprintf.oas::7.2.1:tcrtend.oas::7.2.1:crtninit.xld32::7.2.1:ld32::7.2.1:xm".interp.MIPS.options.reginfo.dynamic.liblist.dynstr.hash.dynsym.MIPS.symlib.rel.dyn.msym.MIPS.stubs.text.init.rodata.data.dtors.eh_frame.ctors.got.sbss.srdata.sdata.lit8.lit4.bss.MIPS.events.init.MIPS.post_rel.text.MIPS.events.text.MIPS.content.sdata.MIPS.content.data.MIPS.content.rodata.MIPS.content.debug_info.MIPS.content.debug_frame.MIPS.content.debug_aranges.debug_info.debug_pubnames.debug_line.debug_aranges.debug_funcnames.debug_abbrev.debug_frame.comment.MIPS.interfaces.shstrtab p 00p ()p<2,,X:[[7@ LL]Hp ,,U  ^p. d&& \p33v  |LPPXXRH``PPplLHp!p!{ p!"? p ʴBp $,p 1Ap !V$Zp "Z*tp #L$'p#pNp%`=pppO pߣ6bp T!p  48  l