# Copyright 1999 by Jeffrey Chang. All rights reserved. # This code is part of the Biopython distribution and governed by its # license. Please see the LICENSE file that should have been included # as part of this package. # Patched by Brad Chapman. # Chris Wroe added modifications for work in myGrid """ This module provides code to work with the WWW version of BLAST provided by the NCBI. http://www.ncbi.nlm.nih.gov/BLAST/ Classes: BlastParser Parses output from WWW blast. _Scanner Scans output from NCBI's BLAST WWW server. Functions: blast Do a BLAST search against the WWW page. (Deprecated) blasturl Do a BLAST search against the stable blasturl. (Deprecated) qblast Do a BLAST search using the QBLAST API. """ import string import re import sgmllib try: import cStringIO as StringIO except ImportError: import StringIO from Bio.ParserSupport import * class BlastParser(AbstractParser): """Parses WWW BLAST data into a Record.Blast object. """ def __init__(self): """__init__(self)""" import NCBIStandalone self._scanner = _Scanner() self._consumer = SGMLStrippingConsumer(NCBIStandalone._BlastConsumer()) def parse(self, handle): """parse(self, handle)""" self._scanner.feed(handle, self._consumer) return self._consumer.data class _Scanner: """Scan BLAST output from NCBI's web server at: http://www.ncbi.nlm.nih.gov/BLAST/ Tested with BLAST v2.0.10 Methods: feed Feed data into the scanner. """ def feed(self, handle, consumer): """S.feed(handle, consumer) Feed in a BLAST report for scanning. handle is a file-like object that contains the BLAST report. consumer is a Consumer object that will receive events as the report is scanned. """ from Bio import File # This stuff appears in 2.0.12. #

# # # BLAST Search Results # #


        # BLAST Formatted information
        
        # 
        # 
        # 
        # 
        # 
        if isinstance(handle, File.UndoHandle):
            uhandle = handle
        else:
            uhandle = File.UndoHandle(handle)
        # Read HTML formatting up to the "BLAST" version line.
        read_and_call_until(uhandle, consumer.noevent,
                            has_re=re.compile(r'.?BLAST'))

        self._scan_header(uhandle, consumer)
	self._scan_rounds(uhandle, consumer)
        self._scan_database_report(uhandle, consumer)
        self._scan_parameters(uhandle, consumer)

        # Read HTML footer information.
        while uhandle.peekline():
            read_and_call(uhandle, consumer.noevent)

    def _scan_header(self, uhandle, consumer):
        # BLASTP 2.0.10 [Aug-26-1999]
        # 
        # 
        # Reference:
        # Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schäffer, 
        # Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
        # "Gapped BLAST and PSI-BLAST: a new generation of protein database sea
        # programs",  Nucleic Acids Res. 25:3389-3402.
        # 

# Query= gi|120291|sp|P21297|FLBT_CAUCR FLBT PROTEIN. # (141 letters) # # Database: Non-redundant SwissProt sequences # 82,258 sequences; 29,652,561 total letters # #

If you have any problems or questions with the results of this # If there are hits, and Graphical Overview was selected: #

#
#
#

Distribution # #
# ' line. # TBLASTN 2.2.6 has a blank line instead of a "

". while 1: line = uhandle.readline() if line[:3] == '

' or not line.strip(): consumer.noevent(line) break consumer.reference(line) # Read the RID line, for version 2.0.12 (2.0.11?) and above. attempt_read_and_call(uhandle, consumer.noevent, start='RID') # Brad Chapman noticed a '

' line in BLASTN 2.1.1; this line # seems to have disappeared again. # attempt_read_and_call(uhandle, consumer.noevent, start='

') attempt_read_and_call(uhandle, consumer.noevent) # Apparently, there's some discrepancy between whether the # Query or database comes first. Usually the Query does, but # Brad noticed a case where the database came first. if uhandle.peekline().find("Query=") >= 0: self._scan_query_info(uhandle, consumer) self._scan_database_info(uhandle, consumer) else: self._scan_database_info(uhandle, consumer) self._scan_query_info(uhandle, consumer) read_and_call_while(uhandle, consumer.noevent, blank=1) consumer.end_header() def _scan_blastform(self, uhandle, consumer): if attempt_read_and_call(uhandle, consumer.noevent, contains="BLASTFORM"): while 1: line = uhandle.peekline() if is_blank_line(line): break elif string.find(line, "Query=") >= 0: break consumer.noevent(uhandle.readline()) def _scan_database_info(self, uhandle, consumer): attempt_read_and_call(uhandle, consumer.noevent, start='

') read_and_call(uhandle, consumer.database_info, contains='Database') # Sagar Damle reported that databases can consist of multiple lines. # But, trickily enough, sometimes the second line can also have the # word sequences in it. Try to use 'sequences;' (with a semicolon) read_and_call_until(uhandle, consumer.database_info, contains='sequences;') read_and_call(uhandle, consumer.database_info, contains='sequences;') read_and_call(uhandle, consumer.noevent, blank=1) attempt_read_and_call(uhandle, consumer.noevent, contains='problems or questions') self._scan_blastform(uhandle, consumer) attempt_read_and_call(uhandle, consumer.noevent, blank=1) if attempt_read_and_call(uhandle, consumer.noevent, start=" # # # # ... #


Query= test # (60 letters) if attempt_read_and_call(uhandle, consumer.noevent, start="
"): read_and_call_until(uhandle, consumer.noevent, start="
")
            while 1:
                line = uhandle.peekline()
                if not line[:5] == "
" or line.find("Query=") >= 0:
                    break
                read_and_call(uhandle, consumer.noevent, start="
")
            
        read_and_call_while(uhandle, consumer.noevent, blank=1)

    def _scan_query_info(self, uhandle, consumer):
        # Read the Query lines and the following blank line.
        read_and_call(uhandle, consumer.query_info, contains='Query=')
        read_and_call_until(uhandle, consumer.query_info, blank=1)
        read_and_call_while(uhandle, consumer.noevent, blank=1)
        if attempt_read_and_call(uhandle, consumer.noevent, start="
"):
            read_and_call_while(uhandle, consumer.noevent, blank=1)
        self._scan_blastform(uhandle, consumer)
        
    def _scan_rounds(self, uhandle, consumer):
        self._scan_descriptions(uhandle, consumer)
        self._scan_alignments(uhandle, consumer)

    def _scan_descriptions(self, uhandle, consumer):
        consumer.start_descriptions()

        # Three things can happen here:
        # 1.  line contains 'Score     E'
        # 2.  line contains "No significant similarity"
        # 3.  no descriptions
        if not attempt_read_and_call(
            uhandle, consumer.description_header,
            has_re=re.compile(r"Score {4,5}E")):
            # Either case 2 or 3.  Look for "No hits found".
            attempt_read_and_call(uhandle, consumer.no_hits,
                                  contains='No significant similarity')
            read_and_call_while(uhandle, consumer.noevent, blank=1)
            consumer.end_descriptions()
            # Stop processing.
            return
        # Sequences producing significant alignments:                      
        # 
        #  into the alignments.
        # What is no alignments are chosen?
        read_and_call_while(uhandle, consumer.description,
                            blank=0, contains='
        if not attempt_read_and_call(uhandle, consumer.noevent,
                                     contains='
'): read_and_call_while(uhandle, consumer.noevent, blank=1) consumer.end_descriptions() def _scan_alignments(self, uhandle, consumer): # Check to see whether I'm at an alignment or database report. # Possibilities: # 1) BLASTP 2.0.14, pairwise alignment #
Alignments
#
        #   >
        #   blast_tmp 1    MFQQIGAVQAKSGTDEPAHPCEKFPPERKCEAVFWKPLPRHEAREILLAARK
        # 4) BLASTP 2.0.10, 2.0.14, database
        #   
        #     Database: Non-redundant SwissProt sequences
        # 5) BLASTX 2.2.4, pairwise alignment
        #   
Alignments
# #
# 6) Qblast 2.2.10, database (no 'Database' line) #
        #  Lambda     K      H

        # Get the first two lines and examine them.
        line1 = safe_readline(uhandle)
        line2 = safe_readline(uhandle)
        uhandle.saveline(line2)
        uhandle.saveline(line1)

        is_pairwise = is_masterslave = 0
#        Was line1, changed to line2. 16-feb-2005. Iddo
#        if string.find(line1, 'Alignments') >= 0:
        if string.find(line2, 'Alignments') >= 0:
            is_pairwise = 1
        elif line2[:10] == '  Database':
            pass
        elif line2[:19] == 'Lambda     K      H':
            pass
        elif line2[:9] == 'blast_tmp':
            is_masterslave = 1
        elif line1[:5] == '
':
            is_pairwise = 1
        else:
            raise SyntaxError, "Cannot resolve location at lines:\n%s\n%s" % (line1, line2)

        if is_pairwise:
            self._scan_pairwise_alignments(uhandle, consumer)
        elif is_masterslave:
            self._scan_masterslave_alignment(uhandle, consumer)

    def _scan_pairwise_alignments(self, uhandle, consumer):
        while 1:
            read_and_call_until(uhandle, consumer.noevent, start='
')
        
            # The first line is 
.  Check the second line to see if
            # I'm still at an alignment.
            line1 = safe_readline(uhandle)
            line2 = safe_readline(uhandle)
            uhandle.saveline(line2)
            uhandle.saveline(line1)
            # Lambda is for Q-blast results, which do not have a Database line
            if line1.find('Database') >= 0 or line2.find("Database") >= 0 \
                or line2.find('Lambda     K      H') >= 0:
                break

            # Occasionally, there's a bug where the alignment_header and
            # hsp_header are skipped, leaving only the hsp_alignment.
            # Detect this and handle it accordingly.
            if line2[:6] == 'Query:':
                self._scan_abbreviated_pairwise_alignment(uhandle, consumer)
            else:
                self._scan_one_pairwise_alignment(uhandle, consumer)

    def _scan_abbreviated_pairwise_alignment(self, uhandle, consumer):
        # Sometimes all header information is skipped, leaving
        # only the raw alignments.  I believe this is a bug because
        # without the header information, you lose vital information such
        # as score, target sequence id, etc.
        # Format:
        # 
        # hsp_alignment

        consumer.start_alignment()
        consumer.start_hsp()
        read_and_call(uhandle, consumer.noevent, start='
')
        self._scan_hsp_alignment(uhandle, consumer)
        consumer.end_hsp()
        consumer.end_alignment()
        
    def _scan_one_pairwise_alignment(self, uhandle, consumer):
        # Alignment format:
        # 
Alignments
# (BLAST 2.0.14) #
        # alignment_header
        #   hsp_header
        #   hsp_alignment
        #   [...]
        # The hsp_header and hsp_alignment blocks can be repeated.

        consumer.start_alignment()
        read_and_call(uhandle, consumer.noevent, start='
')
        self._scan_alignment_header(uhandle, consumer)

        # Scan a bunch of score/alignment's.
        while 1:
            # An HSP header starts with ' Score'.
            # However, if the HSP header is not the first one in the
            # alignment, there will be a '
' line first.  Therefore,
            # I will need to check either of the first two lines to
            # see if I'm at an HSP header.
            line1 = safe_readline(uhandle)
            line2 = safe_readline(uhandle)
            line3 = safe_readline(uhandle)
            uhandle.saveline(line3)
            uhandle.saveline(line2)
            uhandle.saveline(line1)
            # There can be  links in front of 'Score'
            rea = re.compile(r"]*>")
            line1 = rea.sub("", line1)
            line2 = rea.sub("", line2)
            line3 = rea.sub("", line3)
            if line1[:6] != ' Score' and line2[:6] != ' Score' and \
               line3[:6] != ' Score':
                break
            self._scan_hsp(uhandle, consumer)
                
        consumer.end_alignment()

    def _scan_alignment_header(self, uhandle, consumer):
        #  
        
        #  Score = 22.7 bits (47), Expect = 2.5
        #  Identities = 10/36 (27%), Positives = 18/36 (49%)
        #  Strand = Plus / Plus
        #  Frame = +3
        #

        attempt_read_and_call(uhandle, consumer.noevent, start='
')
        attempt_read_and_call(uhandle, consumer.noevent, blank=1)
        read_and_call(uhandle, consumer.score,
                      has_re=re.compile(r'^ (]*>)*Score'))
        read_and_call(uhandle, consumer.identities, start=' Identities')
        # BLASTN
        attempt_read_and_call(uhandle, consumer.strand, start = ' Strand')
        # BLASTX, TBLASTN, TBLASTX
        attempt_read_and_call(uhandle, consumer.frame, start = ' Frame')
        read_and_call(uhandle, consumer.noevent, blank=1)

    def _scan_hsp_alignment(self, uhandle, consumer):
        # Query: 11 GRGVSACA-------TCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGF
        #           GRGVS+         TC    Y  + + V GGG+ + EE   L     +   I R+
        # Sbjct: 12 GRGVSSVVRRCIHKPTCKE--YAVKIIDVTGGGSFSAEEVQELREATLKEVDILRKVSG
        # 
        # Query: 64 AEKILIKR 71
        #              I +K 
        # Sbjct: 70 PNIIQLKD 77
        # 
# # while 1: # Blastn adds an extra line filled with spaces before Query attempt_read_and_call(uhandle, consumer.noevent, start=' ') read_and_call(uhandle, consumer.query, start='Query') read_and_call(uhandle, consumer.align, start=' ') read_and_call(uhandle, consumer.sbjct, start='Sbjct') if not attempt_read_and_call(uhandle, consumer.noevent, blank=1): break read_and_call(uhandle, consumer.noevent, start='
') read_and_call_while(uhandle, consumer.noevent, blank=1) def _scan_masterslave_alignment(self, uhandle, consumer): consumer.start_alignment() read_and_call(uhandle, consumer.noevent, start='
')
        while 1:
            line = safe_readline(uhandle)
            if is_blank_line(line):
                consumer.noevent(line)
            elif line[:6] == '
': consumer.noevent(line) break else: consumer.multalign(line) read_and_call_while(uhandle, consumer.noevent, blank=1) consumer.end_alignment() def _scan_database_report(self, uhandle, consumer): #
        #   Database: Non-redundant SwissProt sequences
        #     Posted date:  Dec 18, 1999  8:26 PM
        #   Number of letters in database: 29,652,561
        #   Number of sequences in database:  82,258
        #   
        # Lambda     K      H
        #    0.317    0.133    0.395 
        # 
        # Gapped
        # Lambda     K      H
        #    0.270   0.0470    0.230 
        # 

        # qblast (BLASTN 2.2.10) does not give the Database: bits before the Lambda
        # information, so that needs to be skipped

        consumer.start_database_report()

        # TBALSTN 2.2.6
        # 
  Database: /tmp/affyA.fasta
        line = uhandle.peekline()
        # only look for database information if we aren't already at the
        # Lambda bits
        if line.find("Database") < 0:
            read_and_call(uhandle, consumer.noevent, start='
')
        line2 = uhandle.peekline()
        if line2.find("Lambda     K      H") < 0:
            read_and_call(uhandle, consumer.database, contains='  Database')
            read_and_call_until(uhandle, consumer.database, contains="Posted")
            read_and_call(uhandle, consumer.posted_date, start='    Posted')
            read_and_call(uhandle, consumer.num_letters_in_database,
                          start='  Number of letters')
            read_and_call(uhandle, consumer.num_sequences_in_database,
                          start='  Number of sequences')
            read_and_call(uhandle, consumer.noevent, start='  ')

        read_and_call(uhandle, consumer.noevent, start='Lambda')
        read_and_call(uhandle, consumer.ka_params)
        read_and_call(uhandle, consumer.noevent, blank=1)

        # not BLASTP
        attempt_read_and_call(uhandle, consumer.gapped, start='Gapped')
        # not TBLASTX
        if attempt_read_and_call(uhandle, consumer.noevent, start='Lambda'):
            read_and_call(uhandle, consumer.ka_params_gap)
        read_and_call_while(uhandle, consumer.noevent, blank=1)

        consumer.end_database_report()

    def _scan_parameters(self, uhandle, consumer):
        # Matrix: BLOSUM62
        # Number of Hits to DB: 1st pass: 41542626, 2nd pass: 9765
        # Number of Sequences: 1st pass: 89405, 2nd pass: 84
        # Number of extensions: 1st pass: 500847, 2nd pass: 6747
        # Number of successful extensions: 1st pass: 14, 2nd pass: 49
        # Number of sequences better than 10.0: 20
        # length of query: 205
        # length of database: 10,955,950
        # effective HSP length: 46
        # effective length of query: 158
        # effective length of database: 6,843,320
        # effective search space: 1081244560
        # effective search space used: 1081244560
        # frameshift window, decay const: 50,  0.5
        # T: 13
        # A: 40
        # X1: 16 ( 7.3 bits)
        # X2: 0 ( 0.0 bits)
        # S1: 41 (21.7 bits)
        # S2: 52 (26.7 bits)
        # 
        # 
# 6/3/2001,
is gone, replaced by consumer.start_parameters() # qblast doesn't have Matrix line attempt_read_and_call(uhandle, consumer.matrix, start='Matrix') # not TBLASTX attempt_read_and_call(uhandle, consumer.gap_penalties, start='Gap') # in qblast the Number of Hits and Number of Sequences lines are # reversed if attempt_read_and_call(uhandle, consumer.num_hits, start='Number of Hits'): read_and_call(uhandle, consumer.num_sequences, start='Number of Sequences') else: read_and_call(uhandle, consumer.num_sequences, start='Number of Sequences') read_and_call(uhandle, consumer.num_hits, start='Number of Hits') read_and_call(uhandle, consumer.num_extends, start='Number of extensions') read_and_call(uhandle, consumer.num_good_extends, start='Number of successful') read_and_call(uhandle, consumer.num_seqs_better_e, start='Number of sequences') # not BLASTN, TBLASTX if attempt_read_and_call(uhandle, consumer.hsps_no_gap, start="Number of HSP's better"): # for qblast order of HSP info is changed if attempt_read_and_call(uhandle, consumer.hsps_prelim_gapped, start="Number of HSP's successfully"): read_and_call(uhandle, consumer.hsps_prelim_gap_attempted, start="Number of HSP's that") read_and_call(uhandle, consumer.hsps_gapped, start="Number of HSP's gapped") else: read_and_call(uhandle, consumer.no_event, start="Number of HSP's gapped") read_and_call(uhandle, consumer.no_event, start="Number of HSP's successfully") read_and_call(uhandle, consumer.no_event, start="Number of extra gapped") # QBlast has different capitalization on the Length info: if attempt_read_and_call(uhandle, consumer.query_length, start='Length of query'): read_and_call(uhandle, consumer.database_length, start='Length of database') read_and_call(uhandle, consumer.no_event, start='Length adjustment') attempt_read_and_call(uhandle, consumer.effective_query_length, start='Effective length of query') read_and_call(uhandle, consumer.effective_database_length, start='Effective length of database') attempt_read_and_call(uhandle, consumer.effective_search_space, start='Effective search space:') attempt_read_and_call(uhandle, consumer.effective_search_space_used, start='Effective search space used') else: attempt_read_and_call(uhandle, consumer.query_length, start='length of query') read_and_call(uhandle, consumer.database_length, start='length of database') read_and_call(uhandle, consumer.effective_hsp_length, start='effective HSP') attempt_read_and_call(uhandle, consumer.effective_query_length, start='effective length of query') read_and_call(uhandle, consumer.effective_database_length, start='effective length of database') attempt_read_and_call(uhandle, consumer.effective_search_space, start='effective search space:') attempt_read_and_call(uhandle, consumer.effective_search_space_used, start='effective search space used') # BLASTX, TBLASTN, TBLASTX attempt_read_and_call(uhandle, consumer.frameshift, start='frameshift') attempt_read_and_call(uhandle, consumer.threshold, start='T') read_and_call(uhandle, consumer.window_size, start='A') read_and_call(uhandle, consumer.dropoff_1st_pass, start='X1') read_and_call(uhandle, consumer.gap_x_dropoff, start='X2') # not BLASTN, TBLASTX attempt_read_and_call(uhandle, consumer.gap_x_dropoff_final, start='X3') read_and_call(uhandle, consumer.gap_trigger, start='S1') attempt_read_and_call(uhandle, consumer.blast_cutoff, start='S2') attempt_read_and_call(uhandle, consumer.noevent, blank=1) attempt_read_and_call(uhandle, consumer.noevent, start="
") attempt_read_and_call(uhandle, consumer.noevent, start="") consumer.end_parameters() def blast(program, database, query, query_from='', query_to='', entrez_query='(none)', filter='L', expect='10', word_size=None, ungapped_alignment='no', # deprecated, not on webpage anymore other_advanced=None, cdd_search='on', composition_based_statistics=None, matrix_name=None, run_psiblast=None, i_thresh='0.001', genetic_code='1', show_overview='on', ncbi_gi='on', format_object='alignment', format_type='HTML', descriptions='100', alignments='50', alignment_view='Pairwise', auto_format='on', cgi='http://www.ncbi.nlm.nih.gov/blast/Blast.cgi', timeout=20, output_fn=None): """blast(program, database, query[, query_from][, query_to] [, entrez_query][, filter][, expect] [, word_size][, other_advanced][, cdd_search] [, composition_based_statistics][, matrix_name][, run_psiblast] [, i_thresh][, genetic_code][, show_overview][, ncbi_gi] [, format_object][, format_type][, descriptions][, alignments] [, alignment_view][, auto_format][, cgi][, timeout]) -> handle Blast against the NCBI Blast web page. This uses the NCBI web page cgi script to BLAST, and returns a handle to the results. See: http://www.ncbi.nlm.nih.gov/blast/html/blastcgihelp.html for more descriptions about the options. Required Inputs: o program - The name of the blast program to run (ie. blastn, blastx...) o database - The database to search against (ie. nr, dbest...) o query - The input for the search, which NCBI tries to autodetermine the type of. Ideally, this would be a sequence in FASTA format. General Options: filter, expect, word_size, other_advanced Formatting Options: show_overview, ncbi_gi, format_object, format_type, descriptions, alignments, alignment_view, auto_format Protein specific options: cdd_search, composition_based_statistics, matrix_name, run_psiblast, i_thresh Translated specific options: genetic code """ import time import urlparse from Bio.WWW import NCBI import warnings warnings.warn("blast is deprecated. Please use qblast instead.", DeprecationWarning) # NCBI Blast is hard to work with. The user enters a query, and then # it returns a "reference" page which contains a button that the user # clicks to retrieve the results. This will retrieve the "results" # page. However, this page may not contain BLAST results if the # search isn't done. # This function will send off the query and parse the reference # page to figure out how to retrieve the results. Then, it needs to # periodically query the results to see if the search has finished. # When it has, then it can retrieve the actual blast results. params = {'PROGRAM' : program, 'QUERY_FROM' : query_from, 'QUERY_TO' : query_to, 'DATABASE' : database, 'QUERY' : query, 'ENTREZ_QUERY' : entrez_query, 'FILTER' : filter, 'EXPECT' : expect, 'WORD_SIZE' : word_size, 'OTHER_ADVANCED': other_advanced, 'CDD_SEARCH' : cdd_search, 'COMPOSITION_BASED_STATISTICS' : composition_based_statistics, 'MATRIX_NAME' : matrix_name, 'RUN_PSIBLAST' : run_psiblast, 'I_THRESH' : i_thresh, 'GENETIC_CODE' : genetic_code, 'SHOW_OVERVIEW' : show_overview, 'NCBI_GI' : ncbi_gi, 'FORMAT_OBJECT' : format_object, 'FORMAT_TYPE' : format_type, 'DESCRIPTIONS' : descriptions, 'ALIGNMENTS' : alignments, 'ALIGNMENT_VIEW' : alignment_view, 'AUTO_FORMAT' : auto_format} default_word_sizes = { 'blastp' : 3, 'blastn' : 11, 'blastx' : 3, 'tblastn' : 3, 'tblastx' : 3 } if not params['WORD_SIZE']: params['WORD_SIZE'] = default_word_sizes.get(params['PROGRAM'], 3) variables = {} for k in params.keys(): if params[k] is not None: variables[k] = str(params[k]) variables['CLIENT'] = 'web' variables['SERVICE'] = 'plain' variables['CMD'] = 'Put' variables['LAYOUT'] = 'OneWindow' if program.upper() == 'BLASTN': variables['PAGE'] = 'Nucleotides' elif program.upper() == 'BLASTP': variables['PAGE'] = 'Proteins' elif program.upper() in ['BLASTX', 'TBLASTN','TBLASTX']: variables['PAGE'] = 'Translations' else: raise ValueError("Unexpected program name %s" % program) # These parameters are not yet implemented. # LCASE_MASK='' # GAPCOSTS='' # PSSM='' # PHI_PATTERN='' # FORMAT_BLOCK_ON_RESPAGE='None' # EMAIL_ADDRESS='' # This returns a handle to the HTML file that points to the results. handle = NCBI._open(cgi, variables, get=0) # Now parse the HTML from the handle and figure out how to retrieve # the results. if output_fn is not None: results = handle.read() output_fn(results) handle = StringIO.StringIO(results) ref_cgi, ref_params = _parse_blast_ref_page(handle) ref_cgi = urlparse.urljoin(cgi, ref_cgi) # convert to absolute URL # Start with the initial recommended delay. refresh_delay = int(ref_params.get("RTOE", 5)) start = time.time() while 1: # pause before trying to get the results time.sleep(refresh_delay) # Sometimes the BLAST results aren't done yet. Look at the page # to see if the results are there. If not, then try again later. handle = NCBI._open(ref_cgi, ref_params, get=0) if output_fn is not None: results = handle.read() output_fn(results) handle = StringIO.StringIO(results) ready, results_cgi, results_params = _parse_blast_results_page(handle) results_params['FORMAT_TYPE']=format_type results_params['NCBI_GI']='yes' results_cgi = urlparse.urljoin(cgi, results_cgi) # to absolute URL if ready: break # Time out if it's not done after timeout minutes. if time.time() - start > timeout*60: raise IOError, "timed out after %d minutes" % timeout # Now query for the actual results. To do this, the CGI script # needs CMD="Get", which should already be in results_params. # Also, for some reason, this fails if FORMAT_OBJECT is in # results_params, so we need to get rid of it. if results_params.has_key("FORMAT_OBJECT"): del results_params["FORMAT_OBJECT"] return NCBI._open(results_cgi, results_params, get=0) class _FormParser(sgmllib.SGMLParser): """Parse a form in an HTML page. Members: forms List of forms in the page. Each form is a tuple of (action, params) where action is a string to the CGI script and params is a dict of keys and values to pass to the script. """ def __init__(self): sgmllib.SGMLParser.__init__(self) self.forms = [] self._current_form = '', {} def start_form(self, attributes): # Parse the "FORM" tag to see where the CGI script is. attr_dict = self._attr2dict(attributes) self._current_form = (attr_dict.get('ACTION', self._current_form[0]), self._current_form[1]) def end_form(self): self.forms.append(self._current_form) self._current_form = '', {} def do_input(self, attributes): params = self._current_form[1] attr_dict = self._attr2dict(attributes) if attr_dict.has_key('NAME'): # Get the value, handling check boxes. value = attr_dict.get('VALUE', attr_dict.get('CHECKED', '')) params[attr_dict['NAME']] = value def _attr2dict(self, attributes): attr_dict = {} for name, value in attributes: attr_dict[string.upper(name)] = value return attr_dict # XXX should handle SELECT, not implemented yet def _parse_blast_ref_page(handle): """_parse_blast_ref_page(handle, base_cgi) -> cgi, parameters""" parser = _FormParser() parser.feed(handle.read()) if len(parser.forms) != 1: raise SyntaxError, "Form broken in BLAST reference page" cgi, params = parser.forms[0] if not params.has_key('RID'): raise SyntaxError, "Error getting BLAST results: RID not found" return cgi, params def _parse_blast_results_page(handle): """_parse_blast_results_page(handle) -> ready, cgi, params""" class _ResultsParser(_FormParser): def __init__(self): _FormParser.__init__(self) self.ready = 0 #_refresh_re = re.compile(r",\s*(\d+)\s*\);") def handle_comment(self, comment): # There is lots of information in the comments of the results # page: # # comment = string.lower(comment) if string.find(comment, 'status=ready') >= 0: self.ready = 1 #elif string.find(comment, 'settimeout') >= 0: # # parse the refresh delay out of the comment # m = self._refresh_re.search(comment) # assert m, "Failed to parse refresh time from %s" % comment # self.refresh = int(m.group(1))/1000 # give in milliseconds parser = _ResultsParser() parser.feed(handle.read()) # The results page has 2 forms. The first one is used if the # results are ready. Otherwise, return the second one. if len(parser.forms) != 2: raise SyntaxError, "I expected 2 forms in the results page." if parser.ready: cgi, params = parser.forms[0] else: cgi, params = parser.forms[1] return parser.ready, cgi, params def blasturl(program, datalib, sequence, ncbi_gi=None, descriptions=None, alignments=None, expect=None, matrix=None, gap_existence=None, gap_extend=None, gapped=None, filter=None, html=None, gcode=None, path=None ): """blasturl(program, datalib, sequence[, ncbi_gi][, descriptions] [, alignments][, expect][, matrix][, gap_existence][, gap_extend] [, gapped][, filter][, html][, gcode]) -> handle Do a BLAST search using the stable URL provided by NCBI. program BLASTP, BLASTN, BLASTX, TBLASTN, or TBLASTX. datalib Which database to search against. sequence The sequence to search. ncbi_gi TRUE/FALSE whether to give 'gi' identifier. Def FALSE. descriptions Number of descriptions to show. Def 100. alignments Number of alignments to show. Def 50. expect An expect value cutoff. matrix Specify an alt. matrix (PAM30, PAM70, BLOSUM80, BLOSUM45). gap_existence Give a gap open penalty. gap_extend Give a gap extension penalty. gapped TRUE/FALSE for giving gapped alignments. Def TRUE. filter "none" turns off filtering. Default uses 'seg' or 'dust'. html TRUE/FALSE for html output. Def FALSE. gcode Specify an alternate genetic code for (T)BLASTX. This function does no checking of the validity of the parameters and passes the values to the server as is. More help is available at: http://www.ncbi.nlm.nih.gov/BLAST/blast_overview.html """ import warnings warnings.warn("blasturl is deprecated. Please use qblast instead.", DeprecationWarning) lines = [] lines.append('PROGRAM %s' % program) lines.append('DATALIB %s' % datalib) parameters = [('NCBI_GI', ncbi_gi), ('DESCRIPTIONS', descriptions), ('ALIGNMENTS', alignments), ('EXPECT', expect), ('MATRIX', matrix), ('GAP_EXISTENCE', gap_existence), ('GAP_EXTEND', gap_extend), ('GAPPED', gapped), ('FILTER', filter), ('HTML', html), ('GCODE', gcode), ('PATH', path), ] for name, value in parameters: if value is not None: lines.append("%s %s" % (name, value)) lines.append('') lines.append('BEGIN') while sequence: lines.append(sequence[:60]) sequence = sequence[60:] message = string.join(lines, '\n') outhandle = StringIO.StringIO() _send_to_blasturl(message, outhandle) outhandle.seek(0) # Reset the handle to the beginning. return outhandle def _send_to_blasturl(query, outhandle): """_send_to_blasturl(query, outhandle) Send a BLAST request to the stable blasturl server at the NCBI. ftp://ncbi.nlm.nih.gov/blast/blasturl/ The results are written to outhandle. """ import socket sock = socket.socket(socket.AF_INET, socket.SOCK_STREAM) sock.connect(('www.ncbi.nlm.nih.gov', 80)) sock.send('POST /cgi-bin/BLAST/nph-blast_report HTTP/1.0\n') sock.send('User-Agent: BiopythonClient\n') sock.send('Connection: Keep-Alive\n') sock.send('Content-type: application/x-www-form-urlencoded\n') sock.send('Content-Length: %d\n' % len(query)) sock.send('\n') sock.send(query) while 1: data = sock.recv(1024) if not data: break outhandle.write(data) sock.close() def qblast(program, database, sequence, ncbi_gi=None, descriptions=None, alignments=None, expect=None, matrix=None, filter=None, format_type="XML", hitlist_size=None, entrez_query='(none)', ): """Do a BLAST search using the QBLAST server at NCBI. program BLASTP, BLASTN, BLASTX, TBLASTN, or TBLASTX. database Which database to search against. sequence The sequence to search. ncbi_gi TRUE/FALSE whether to give 'gi' identifier. Def FALSE. descriptions Number of descriptions to show. Def 500. alignments Number of alignments to show. Def 500. expect An expect value cutoff. Def 10.0. matrix Specify an alt. matrix (PAM30, PAM70, BLOSUM80, BLOSUM45). filter "none" turns off filtering. Default uses 'seg' or 'dust'. format_type "HTML", "Text", "ASN.1", or "XML". Def. "XML". entrez_query Entrez query to limit Blast search This function does no checking of the validity of the parameters and passes the values to the server as is. More help is available at: http://www.ncbi.nlm.nih.gov/BLAST/blast_overview.html """ import urllib, urllib2 from Bio.WWW import RequestLimiter assert program == 'blastn' or program == 'blastp' # hitlist_size parameter contributed by Sjoerd de Vries. parameters = [ ('QUERY', sequence), ('PROGRAM', program), ('ENTREZ_QUERY', entrez_query), ('DATABASE', database), ('EXPECT', expect), ('HITLIST_SIZE', hitlist_size), ('MATRIX_NAME', matrix), ('FILTER', filter), ('CMD', 'Put'), ] query = [x for x in parameters if x[1] is not None] message = urllib.urlencode(query) # Send off the initial query to qblast. request = urllib2.Request("http://www.ncbi.nlm.nih.gov/blast/Blast.cgi", message, {"User-Agent":"BiopythonClient"}) handle = urllib2.urlopen(request) # Format the query now. rid, rtoe = _parse_qblast_ref_page(handle) parameters = [ ("RID", rid), ('DESCRIPTIONS', descriptions), ('ALIGNMENTS', alignments), ('NCBI_GI', ncbi_gi), ('FORMAT_TYPE', format_type), ("CMD", "Get"), ] query = [x for x in parameters if x[1] is not None] message = urllib.urlencode(query) # Poll NCBI until the results are ready. limiter = RequestLimiter(3) while 1: limiter.wait() request = urllib2.Request("http://www.ncbi.nlm.nih.gov/blast/Blast.cgi", message, {"User-Agent":"BiopythonClient"}) handle = urllib2.urlopen(request) results = handle.read() # XML results don't have the Status tag when finished if results.find("Status=") < 0: break i = results.index("Status=") j = results.index("\n", i) status = results[i+len("Status="):j].strip() if status.upper() == "READY": break return StringIO.StringIO(results) def _parse_qblast_ref_page(handle): """Return tuple of RID, RTOE.""" s = handle.read() i = s.find("RID =") j = s.find("\n", i) rid = s[i+len("RID ="):j].strip() i = s.find("RTOE =") j = s.find("\n", i) rtoe = s[i+len("RTOE ="):j].strip() return rid, int(rtoe)